KEGG   Pseudomonas fluorescens Pf0-1: Pfl01_0690Help
Entry
Pfl01_0690        CDS       T00283                                 

Definition
DNA helicase/exodeoxyribonuclease V subunit alpha (EC:3.1.11.5)
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
pfo  Pseudomonas fluorescens Pf0-1
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:pfo03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
815535..817643
Genome map
AA seq 702 aa AA seqDB search
MNRTFADLLPTPLTAESLAQLTPLTRADDLLLLLTQWVERGWLRALDKAFVAFLHELESD
VDPLVLLAAALTSHQLGHGHVCLDLFETLKAPDFALSLPPEGDAQPGVLLLPSQLLETLD
GAHWCKVLAGSSLVALAADESASAQERPLVLSGKRLYLRRYWAYERRIDSALRQRLAEQE
ATPPDLARRLNELFDPAQRADVIDWQKLACALATRGAFSIITGGPGTGKTTTVVRLLALL
QAPAVEAHQPLRIRLAAPTGKAAARLTESISQQVQSLKVADSVREKIPTEVTTVHRLLGS
RPGTRHFRHHAGNRLPLDVLVVDEASMIDLEMMANLLDALPPHARLVLLGDKDQLASVEA
GAVLGDLCRDAEAGWYSAQTRQWLEQVSGESLQDSGLHEGTDGSHPLAQQVVMLRHSRRF
GEGSGIGQLARRVNQQLPVEARQLLEAKTHGDVFSLPLHNEHDRELEHLVLDGHAKGPHG
YRHYLSVLRDRRPASGTPLENPCWVDWARDVLRAFDTFQLLCAVRKGPWGVEGLNQRITE
ALLKARLIESDQQWYEGRPVLMTRNDYGLGLMNGDIGIALKLPERDGPDAGKSVLRVAFP
RNDGRGGVRFVLPSRLNDVETVYAMTVHKSQGSEFAHTALILPDALNPVLTKELIYTGIT
RAKDWFTLIEPRSGVFEEAVQRKVKRLSGLMLELEEGAPHKG
NT seq 2109 nt NT seq  +upstreamnt  +downstreamnt
atgaatcggacattcgccgacctgctgcctacgccgctgaccgccgaaagcctcgcgcaa
ttgacacccctgacccgtgccgatgatcttttgctgttgctgacccaatgggtcgagcgt
ggctggttgcgggcactggacaaggcattcgtggcctttcttcatgagttggaatccgat
gtcgatccgctggtgttgctcgccgccgcattgaccagtcaccagctcggccatggtcat
gtctgcctggatctgttcgaaaccctcaaggcaccggattttgcactttccctgccgccg
gagggggatgcgcaacccggcgtgttgctgctgccatcgcaattgctcgaaaccctcgac
ggagcgcactggtgcaaggtgctggccggcagttcgctggtggcactggccgccgacgag
agtgcgtcggctcaggagcgcccactggtgttgtccggcaagcgtttgtacttgcggcgc
tattgggcctacgagcggcgtatcgacagcgcactgcgtcagcgactcgcggagcaggaa
gcgacaccacccgatcttgcacgccggctgaacgaactgttcgatccggcccagcgtgcg
gatgtcatcgactggcagaaactcgcctgcgccctggccacccgaggtgccttcagcatc
atcacgggtggcccgggtaccggcaagacgacgacggtggtccgtttgctggcgttgctc
caggcacctgcggtcgaggcgcatcaaccattgcgcataaggctcgcggcgcctaccgga
aaagcggcggcgcggctgaccgagtccatcagtcagcaggtgcaatcgctgaaggtcgct
gacagcgtccgggaaaaaatcccgaccgaggtgaccacggtgcaccgcctgctcggtagt
cgtcccggcacgcggcactttcgccaccatgccggtaaccgtctgcccctggacgttctg
gtggtcgatgaagcgtccatgatcgacctggaaatgatggccaatctgctcgatgccttg
ccgcctcatgcccgattggtgttgctgggcgacaaggatcaacttgcctccgtggaggcg
ggtgcggtgctgggagatttgtgccgtgatgccgaagctggttggtacagtgcgcagacc
cgccagtggctggaacaggtgagtggcgaatccctgcaggacagcggcttgcacgaaggc
actgacggctcgcatccattggcccagcaagtggtgatgctgcgacactcgcggcgtttc
ggcgagggcagcggcatcggtcaactggcgcgacgagtgaatcagcaactcccggtcgag
gctcgccagttgctggaagccaagactcatggcgatgtgttttctttgccactccacaat
gagcacgaccgtgaactcgagcacctggtgctcgatgggcacgcgaaaggccctcacgga
tatcgacactatctgagcgtcttgcgcgatcgacgtccggcgagcggaacgccgctcgag
aacccgtgttgggtcgactgggcacgtgacgtcctgcgggccttcgataccttccagttg
ttgtgcgcagtgcgcaaagggccgtggggtgtggaggggctgaaccagcgcatcaccgaa
gcgttgctcaaggcgcggctgatcgagagcgaccagcaatggtacgaaggccggccggtg
ctgatgacccgaaacgactacggtctggggctgatgaacggtgacatcggtatcgccctg
aaactgcccgagcgcgatggccctgatgccggtaaatcggtattgcgagtggcgttcccg
cgtaacgacgggcgcggcggggtgcgtttcgtgttgccgagccggctcaacgatgtcgag
accgtctatgcgatgaccgtgcacaagtctcagggctcggagtttgcccataccgcgctg
atcctgccggacgccctgaatcctgtgttgaccaaggaactgatctataccggaattacc
cgggccaaggactggttcaccttgatcgagcctcggagcggcgtgtttgaagaagcggtg
cagcgcaaggtgaagcgcctgagtggactgatgctggaactggaagaaggcgcgccgcat
aaaggatga

DBGET integrated database retrieval system