KEGG   Pseudomonas fluorescens Pf0-1: Pfl01_0869Help
Entry
Pfl01_0869        CDS       T00283                                 

Definition
UDP-N-acetylglucosamine 1-carboxyvinyltransferase (EC:2.5.1.7)
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
pfo  Pseudomonas fluorescens Pf0-1
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:pfo00520]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:pfo00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1014183..1015448
Genome map
AA seq 421 aa AA seqDB search
MDKLIITGGARLDGEIRISGAKNSALPILAATLLCDGPVTVGNLPHLHDITTMIELFGRM
GIEPVIDEKLSVEIDPRTIKTLIAPYELVKTMRASILVLGPMVARFGEAEVALPGGCAIG
SRPVDLHIRGLEAMGAVIDVEGGYIKAKAPEGGLRGAHFFFDTVSVTGTENIMMAAALAK
GRSVLQNAAREPEVVDLANFLNAMGAKVSGAGTDTITIDGVERLGSAFYKVMPDRIETGT
YLVAAAVTGGRVKVKDTDPTILEAVLEKLREAGAEITCGEDWIELNMHGKRPKAVNVRTA
PYPAFPTDMQAQFISLNAIAEGTGAVIETIFENRFMHVYELHRMGAHIQVEGNTAIVTGI
ETLKGAPVMATDLRASASLVISALVAQGDTLIDRIYHIDRGYECIEEKLQMLGAKIRRVP
G
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
atggataaattgattattaccggtggcgctcgtcttgatggcgagatccgcatctccggg
gcgaagaactccgccctgccgatcctggccgccaccctgctgtgcgatggcccggttacc
gtcggcaacctgccgcacctgcatgacatcaccaccatgatcgagctgttcggtcgcatg
ggcatcgagcctgtgatcgacgagaagctcagcgtcgaaatcgacccgcgcaccatcaag
accctgatcgccccgtacgaactggtgaaaaccatgcgtgcgtcgatcctggtgctgggc
ccgatggttgcgcgtttcggtgaagccgaagtcgcactgcctggcggttgcgccatcggt
tcgcgtccggtcgaccttcacatccgtggcctggaagccatgggcgcagtcatcgatgtc
gaaggcggctacatcaaggccaaggcgcctgaaggcggcctgcgcggcgcgcacttcttc
ttcgataccgtcagtgtgaccggtaccgagaacatcatgatggctgccgctctggccaag
ggccgcagcgtgttgcagaacgccgctcgcgaacctgaagtggtcgacctggcgaacttc
ctcaacgccatgggtgccaaggtttccggtgccggaaccgacaccatcaccatcgacggc
gtcgagcgtctgggctcggccttctataaggtcatgcctgaccgtatcgaaaccggcacc
tacctggtggccgctgcggttaccggtggccgcgtgaaggtcaaggacaccgatccgacc
atcctcgaagccgttctggaaaaactccgtgaagccggtgcagaaatcacctgtggtgaa
gactggatcgagctgaacatgcacggcaagcgcccgaaagcggtcaacgtgcgcactgcg
ccgtatccggcgttcccgaccgacatgcaggcgcagttcatctcgctcaacgccattgcc
gaaggcaccggtgccgtgatcgagacgatcttcgaaaaccgcttcatgcacgtgtacgaa
ctgcaccgcatgggcgcgcacatccaggtcgaaggcaacaccgccattgtgaccggtatc
gaaacactcaagggcgcgccagtgatggcaaccgacctgcgtgcttcggcgagcctggtg
atttcggcgctggtggcacagggcgataccctgatcgaccgcatctaccacatcgaccgt
ggttacgagtgcatcgaggaaaaactgcagatgctgggcgccaagatccgtcgcgttccg
ggctaa

DBGET integrated database retrieval system