KEGG   Pseudomonas fluorescens Pf0-1: Pfl01_0871Help
Entry
Pfl01_0871        CDS       T00283                                 

Gene name
hisD
Definition
histidinol dehydrogenase (EC:1.1.1.23)
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
pfo  Pseudomonas fluorescens Pf0-1
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:pfo00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Pfl01_0871 (hisD)
  Amino acid metabolism
   00340 Histidine metabolism
    Pfl01_0871 (hisD)
Enzymes [BR:pfo01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     Pfl01_0871 (hisD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1016337..1017662
Genome map
AA seq 441 aa AA seqDB search
MTAPTAIRRLNAADPDFAHHLDHLLSWESVSDDSVNQRVLDIIKAVRERGDAALVEFTQK
FDGLEVASMADLILPRERLELALTRITVAQREALEKAAARVRSYHEKQKQDSWSYTEADG
TVLGQKVTPLDRAGLYVPGGKASYPSSVLMNAIPAKVAGVTEVVMVVPTPRGEVNELVLA
AACIAGVDRVFTIGGAQAVAALAYGTESVPQVDKVVGPGNIYVATAKRHVFGQVGIDMIA
GPSEILVVCDGQTDPDWIAMDLFSQAEHDEDAQAILVSPDAEFLDKVAASIDKLLPTMDR
ATIIETSINGRGALIHVRDMAQAIEVANRIAPEHLELSVADPQAWLPQIRHAGAIFMGRH
TSEALGDYCAGPNHVLPTSGTARFSSPLGVYDFQKRSSIIFCSEAGASELGKTASILARG
ESLSAHARSAEYRIKDDVKGN
NT seq 1326 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcaccgactgcaattcgccgactcaacgctgctgacccggatttcgcgcatcat
ctggatcatctgctgagctgggaaagtgtgtctgacgactcggtcaatcagcgggtgctg
gacatcatcaaggctgtgcgcgagcgcggtgacgcggcgctggtcgagttcacccagaaa
ttcgacggcctcgaagtcgcctccatggcagacctgatcctgccgcgcgagcgtctggaa
ctggccctgacccgtatcaccgtggctcaacgcgaagcgctggaaaaagccgccgcccgt
gtgcgcagctatcacgaaaaacagaagcaggactcctggagctacaccgaagccgacggc
accgtgctgggccagaaggtcacgccgctggatcgcgccggtctgtatgtgccgggcggc
aaggcgtcgtacccgtcgtcggtgttgatgaatgcgattccggccaaggtcgctggcgtg
actgaagtggtcatggtggtgccaaccccgcgtggcgaggtcaacgaactggtgctggcg
gcggcgtgcattgccggcgtcgaccgggtgttcaccatcggtggcgcacaagccgttgct
gcgttggcctatggcaccgaaagcgtgccgcaggtggacaaggtcgtcggcccgggcaac
atctatgtcgccactgccaagcgtcacgtgttcggtcaggtcggcatcgacatgattgcc
ggcccgtctgaaatcctcgtggtgtgcgacggccagaccgatccggactggatcgccatg
gacctgttctcccaggccgaacacgacgaagacgcccaggcgattctggtcagcccggac
gccgagttcctcgacaaggtcgccgcgagcatcgacaagctgctgccgaccatggatcgc
gcaaccatcatcgaaacctcgatcaacggccgtggtgccctgattcacgtgcgcgacatg
gcccaggccatcgaagtcgccaaccgcattgccccggaacaccttgagctgtcggtcgcc
gaccctcaggcctggctgccgcagatccgccacgccggcgcgattttcatgggccgccac
acctccgaggcgctgggcgactactgcgcgggtccgaaccacgtgctgccgacctccggc
actgcgcgtttctcttcgccgctgggcgtgtacgacttccagaaacgctcgtcgatcatc
ttctgctccgaggccggcgcttcggagcttggcaagactgcatcgattctggcccgtggc
gaatcgctgagcgcccacgcgcgtagcgccgaataccgcatcaaagacgacgtgaagggg
aactga

DBGET integrated database retrieval system