KEGG   Pseudomonas fluorescens Pf0-1: Pfl01_0892Help
Entry
Pfl01_0892        CDS       T00283                                 

Definition
short chain dehydrogenase
Orthology
K13938  
dihydromonapterin reductase / dihydrofolate reductase [EC:1.5.1.- 1.5.1.3]
Organism
pfo  Pseudomonas fluorescens Pf0-1
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:pfo00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Pfl01_0892
   00670 One carbon pool by folate
    Pfl01_0892
Enzymes [BR:pfo01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     Pfl01_0892
    1.5.1.-  
     Pfl01_0892
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1037495..1038205)
Genome map
AA seq 236 aa AA seqDB search
MTSPTAPILITGAGQRVGLHCAQRLLEDGHRVIFTYRSERPGVKTLRDLGALGLHADFSS
EASILAFITELKSHTDSLRAIVHNASEWLAETADGEAEAFSRMFNIHMLAPYLINLHCAE
LLQRSSPADIIHISDDVTRKGSSKHIGYCASKAGLDSLTLSFAARYAPSIKVNGIAPALL
LFNPDDDAEYRAKALAKSALGIEPGSEVIYQSLRYLLDNPYVTGTTLTVNGGRHVK
NT seq 711 nt NT seq  +upstreamnt  +downstreamnt
atgacttctcccaccgctcccatccttatcaccggcgccggccagcgggtcggcctgcat
tgtgcgcagcgtctgctggaagatggtcatcgggtgatcttcacttaccgcagcgaacgg
ccgggtgtgaagaccttgcgggatctgggcgccctagggctgcacgcggacttttccagc
gaagcttcgatcctcgccttcatcaccgagctgaagtcacacaccgacagcctgcgcgcg
atcgtgcacaacgcctcggagtggctggcggaaaccgctgacggcgaagccgaagccttc
agccgcatgttcaacattcacatgctggcgccgtacctgatcaatctgcattgcgctgaa
ttgctgcaacgttcgagtcctgccgacatcatccacatcagcgatgacgtcacccgcaag
ggcagcagcaaacacatcggctattgcgccagcaaggccgggctcgacagtctcacgctg
tccttcgccgcgcgctacgcgccgtcaatcaaggtcaacggcatcgcaccggccctgcta
ttgttcaatcccgacgacgacgcggagtaccgtgccaaggcgctggccaagtccgcgctg
ggcatcgaacccggcagcgaagtgatttatcagagcctgcgttatctgctcgacaacccg
tatgtcaccggcaccaccctgaccgtcaacggcgggcggcacgtcaagtaa

DBGET integrated database retrieval system