KEGG   Pseudomonas fluorescens Pf0-1: Pfl01_0988Help
Entry
Pfl01_0988        CDS       T00283                                 

Definition
DNA polymerase III subunit chi (EC:2.7.7.7)
Orthology
K02339  
DNA polymerase III subunit chi [EC:2.7.7.7]
Organism
pfo  Pseudomonas fluorescens Pf0-1
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Mismatch repair
Homologous recombination
Module
DNA polymerase III complex, bacteria
Brite
KEGG Orthology (KO) [BR:pfo00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Pfl01_0988
   00240 Pyrimidine metabolism
    Pfl01_0988
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    Pfl01_0988
   03430 Mismatch repair
    Pfl01_0988
   03440 Homologous recombination
    Pfl01_0988
Enzymes [BR:pfo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     Pfl01_0988
DNA replication proteins [BR:pfo03032]
 Prokaryotic Type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     Pfl01_0988
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1148810..1149238)
Genome map
AA seq 142 aa AA seqDB search
MTKVDFYILPSADPSARLDFACKLTDKAWRMGHRIYLHCSDAAQRDDLDARLWAFKGETF
VPHGPAESEPEGLIVLGVGEDCGQHTDLLVNLDLKVPVFASKFARVAEVVVEDPAIRTAA
RESFRFYREQGYPLQDHRLQRL
NT seq 429 nt NT seq  +upstreamnt  +downstreamnt
atgaccaaagtcgacttttatatcctgcccagcgccgatccttcggctcgcctggacttt
gcctgcaagctcaccgataaagcctggcgcatgggccatcgcatctacctgcattgcagc
gatgccgcccagcgtgatgatctcgatgcgcgcctgtgggcgttcaagggtgaaaccttc
gtgcctcacggcccggctgaaagcgagccggaaggtttgatcgtattgggagtgggcgag
gactgtggccagcacacagacttgctggtcaacctcgacctgaaagtcccggttttcgcc
agtaaattcgcccgcgttgccgaggtggtggtggaagatccggcgatccgcactgcggcg
cgggagagtttccgtttctaccgcgaacagggctatcctctgcaagaccaccgtttacag
cgactctga

DBGET integrated database retrieval system