KEGG   Pseudomonas fluorescens Pf0-1: Pfl01_1026Help
Entry
Pfl01_1026        CDS       T00283                                 

Definition
glutaredoxin
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
pfo  Pseudomonas fluorescens Pf0-1
Brite
Enzymes [BR:pfo01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     Pfl01_1026
Secretion system [BR:pfo02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   Pfl01_1026
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1189880..1190611
Genome map
AA seq 243 aa AA seqDB search
MRLTQIFAAAAIALVSTFAVADDAADKAIRQSLENLQLDVPVDTITASPLPGLYEVKLKG
SRVLYASADGQYIVQGYMFQLKDGKPVNLTEKTERLGISKLINAIPVAETVVYPAVGETK
SHITVFTDTTCPYCHKLHAEVPELNKRGIEVRYVAFPRQGLGSPGDEQLQAVWCSKDKKA
AMDKMVDGKEIKAAKCENPVSKQFALGQTIGVNGTPAIVLADGQVIPGYQPAPQVAKLAL
GAK
NT seq 732 nt NT seq  +upstreamnt  +downstreamnt
atgcgtctgacccagattttcgccgccgcagccattgcgttggtcagcacctttgccgtc
gccgatgacgcggccgacaaagcgattcgccaaagcctggaaaacctccagctcgacgtg
ccggtggacaccatcaccgccagcccgctgccgggcctttacgaagtcaagctcaagggc
agccgcgtgctgtacgccagcgccgatggccagtacatcgttcaggggtacatgttccag
ctcaaggacggcaaaccggtcaacttgaccgagaagaccgagcgcctgggcatttccaaa
ctgatcaacgcgatcccggtggccgagaccgtggtttacccggccgtgggcgaaaccaag
tcgcacatcaccgttttcaccgacaccacctgcccgtattgccacaagctgcacgccgaa
gtgccggagctgaacaagcgcggcatcgaagtgcgctacgtcgcgttcccgcgccaaggc
ctcggctcgccgggtgacgaacagctgcaagccgtgtggtgctccaaagacaagaaagcc
gccatggacaaaatggtcgacggcaaggaaatcaaggccgccaagtgcgagaacccggtt
tccaaacagttcgccctcggtcagacgatcggcgtgaacggtacaccggccatcgttttg
gccgacggacaagtcattccgggctaccagcctgcgccacaagtcgccaaactggcgctg
ggcgcgaagtaa

DBGET integrated database retrieval system