KEGG   Pseudomonas fluorescens Pf0-1: Pfl01_1057Help
Entry
Pfl01_1057        CDS       T00283                                 

Definition
chemotaxis-specific methylesterase (EC:3.1.1.61)
Orthology
K13491  
two-component system, chemotaxis family, response regulator WspF [EC:3.1.1.61]
Organism
pfo  Pseudomonas fluorescens Pf0-1
Pathway
Two-component system
Module
WspE-WspRF (chemosensory) two-component regulatory system
Brite
KEGG Orthology (KO) [BR:pfo00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Pfl01_1057
Enzymes [BR:pfo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     Pfl01_1057
Two-component system [BR:pfo02022]
 CheA family
  WspE-WspRF [MD:M00509]
   Pfl01_1057
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1225571..1226581
Genome map
AA seq 336 aa AA seqDB search
MKIAIVNDMPLAVEALRRALAFEPAHQVVWVASNGAEAVRLCAENTPDLILMDLIMPVMD
GVEATRRIMAESPCAIVIVTVDRQQNVHRVFEAMGHGALDVVDTPAIGGGNPQEAAAPLL
RKILNIGWLIGEKTARSRPAPAAPRSTASRQRLVAIGSSAGGPAALEVLLKGLPRHFSAA
IVLVQHVDQVFAAGMAEWLASASGLDVRLAREGEPPQAGAVLLAGTNHHIRLLKNGTLAY
TAEPVNEIYRPSIDVFFESVANYWNGDAVGVLLTGMGRDGAQGLKLMRQQGYLTIAQDQQ
SSAVYGMPKAAAAIDAAVEIRPLEKIAPRLLEIFPK
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgaagatcgcaatcgtcaatgacatgcctctggcggtggaagccctgcgtcgtgcgctg
gccttcgagccggcgcatcaggtggtgtgggtcgccagcaacggcgccgaagcggtgcgc
ctgtgcgcggaaaacaccccggacctgatcctgatggacctgatcatgccggtgatggat
ggcgtcgaggccacccgccggatcatggccgagagcccgtgcgcgatcgtcatcgtcacc
gtggaccgccagcagaacgtgcaccgggtgttcgaagccatgggccacggcgcgctggac
gtggtcgacaccccggccatcggcggtggcaaccctcaggaagcggcggcgccactgctg
cgtaaaatccttaatatcggctggctgatcggcgagaaaaccgcccgctcgcgccccgca
cctgcggcaccgcgcagtaccgcctcgcgccagcggctggtggcgatcggctcttcggcc
ggtggtccggcggcgctggaagtcttgctcaagggcctgccacgccacttttcggcggcc
atcgtgctggtgcagcatgttgatcaggtgttcgccgccggcatggccgaatggctggcc
agcgccagcggtctggatgtgcgtctggcccgcgaaggcgaaccgccgcaggccggcgcg
gtgttgctggccggcaccaaccaccatattcgtttgctcaagaacggcacgctggcctac
accgccgagccggtcaacgagatctaccgcccctcgatcgacgtgtttttcgaaagcgtc
gccaactactggaatggtgacgcagtaggggttttattgacagggatgggacgcgacggg
gctcaagggcttaagctcatgcgtcaacagggctatctgaccatcgcgcaggatcagcaa
agcagtgcggtgtacggcatgcccaaggctgccgcagccatcgacgcggccgtagaaatc
cgtccactggaaaagatagcgccacgattgctggagatattccccaaatga

DBGET integrated database retrieval system