KEGG   Pseudomonas fluorescens Pf0-1: Pfl01_1130Help
Entry
Pfl01_1130        CDS       T00283                                 

Gene name
pcm
Definition
protein-L-isoaspartate O-methyltransferase (EC:2.1.1.77)
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
pfo  Pseudomonas fluorescens Pf0-1
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1306541..1307218
Genome map
AA seq 225 aa AA seqDB search
MAREQDDRLRSGIGMTSQRTRERLIQRLYEEGVSNASVLEVIRRTPRHLFVDEALAHRAY
EDTALPIGNNQTISQPYMVARMSELLLEAGPLDKVLEIGTGSGYQTAVLSQLVERVFSVE
RIKVLQDRAKERLIELNLRNVVFRWGDGWEGWPALAPYNGIIVTAVATDVPQALLDQLAP
GGRMVIPVGSGEVQQLMLIVREENGFSRHVLGAVRFVPLLNGPLA
NT seq 678 nt NT seq  +upstreamnt  +downstreamnt
atggctcgtgaacaagacgacaggctgcgcagcggcatcgggatgacgtcccagcgaacc
cgtgagcgcctgatccagcgtctgtacgaagagggcgtttccaacgccagcgtgctggaa
gtgatccgccgcaccccgcgacacctgttcgtcgatgaagcgctggcgcatcgtgcctat
gaagacaccgcgctgccgatcggcaacaaccagaccatttcccagccttatatggtggcg
cgcatgagcgagctgctgctggaagccgggccgctggataaggtgctggagatcggcacc
ggatccggttaccagacggcagtgttgtcgcagttggtcgagcgggtgttctcggtagag
cgcatcaaggtgctgcaggatcgggccaaggaacgcctgatcgagctcaacctgcgcaac
gtggtatttcgctggggcgatggttgggaagggtggccggcgctagcgccgtacaacggc
atcatcgtcacggcggtcgccaccgatgtgcctcaggctttgcttgatcaactggcaccg
ggtgggcggatggtgatcccggtcggttcgggcgaagtgcagcaattgatgctgatcgtg
cgcgaagaaaacggtttctcccgacacgttctgggggcggtgcgtttcgtgccattgctc
aacggtccgctggcctga

DBGET integrated database retrieval system