KEGG   Pseudomonas fluorescens Pf0-1: Pfl01_1512Help
Entry
Pfl01_1512        CDS       T00283                                 

Definition
dTDP-4-dehydrorhamnose 3,5-epimerase (EC:5.1.3.13)
Orthology
K01790  
dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
pfo  Pseudomonas fluorescens Pf0-1
Pathway
Streptomycin biosynthesis
Polyketide sugar unit biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pfo00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    Pfl01_1512
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Pfl01_1512
Enzymes [BR:pfo01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     Pfl01_1512
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1699477..1700037
Genome map
AA seq 186 aa AA seqDB search
MSEFSLKPLPLAGLFSVQHKRFEDQRGHFARLFCEGSLKAFGSEFHIRQINHSCTREKGS
VRGLHYQNANAPEAKLITCLRGEVWDVAVDLRPDSETFLHWHAEHLKAGDGRSLLIPAGF
AHGFQTLTEDAELLYLHSADYAPEHEGGLSVNDPRLAIAWPLPVNNLSARDSSHPALDQH
FAGVRL
NT seq 561 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgagttttccttgaaaccgttgccgctggccgggttgttcagcgtccagcacaag
cgcttcgaagatcagcgcgggcacttcgcccgtctgttctgcgaaggcagcctgaaagcg
ttcggcagtgaatttcacatccgccagatcaaccattcctgcacccgcgagaagggcagc
gtgcgcggtctgcattaccagaacgccaatgcgccggaagccaagttgatcacctgcctg
cgaggtgaagtgtgggacgtagcggtagacctgcgcccggactcggaaaccttcctgcac
tggcacgccgagcacctgaaggccggtgacggtcgcagcctgttgattccggccggcttc
gcccacggtttccagaccctcactgaagacgccgaactgctttacctgcacagcgccgat
tacgcgccggagcacgagggcggtctgtcggtgaacgatccacggctggcgatcgcctgg
ccgttgcctgtcaataatttgtcagcgcgtgattccagccatcccgcgctcgatcaacac
tttgctggagtgcgtctatga

DBGET integrated database retrieval system