KEGG   Pseudomonas fluorescens Pf0-1: Pfl01_1615Help
Entry
Pfl01_1615        CDS       T00283                                 

Definition
dihydrolipoamide succinyltransferase (EC:2.3.1.61)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
pfo  Pseudomonas fluorescens Pf0-1
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:pfo00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Pfl01_1615
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Pfl01_1615
  Amino acid metabolism
   00310 Lysine degradation
    Pfl01_1615
Enzymes [BR:pfo01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Pfl01_1615
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1805919..1807142
Genome map
AA seq 407 aa AA seqDB search
MAIEIKAPTFPESVADGTVATWHKQPGDAVKRDELIVDIETDKVVLEVLATADGVLGAIV
KGEGETVLSDEVLGSIVEGGAASAAPAAAAAPAAAAAAPAAADGEDDPIAAPAARKLAEE
NGINIASVAGTGKGGRVTKEDVVAAVAAKKAAPAAAPAKAAAPAAAAPVFAAGDRIEKRV
PMTRVRATVAKRLVEAQSNMAMLTTFNEVDMTEVMALRSKYKDLFEKSHNGVRLGFMSFF
VKAATEALKRFPAVNASIDGNDIVYHGYADIGVAVSSDRGLVVPVLRNAEHMSLAEIEGG
IATFGKKARDGKLSMDEMTGGTFTITNGGTFGSMMSTPIVNPPQAAILGMHNIIQRPMAI
NGQVVIRPMMYLALSYDHRLIDGKEAVTFLVTIKNLLEDPARLLLDI
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
atggctatcgagatcaaagcccccactttcccggaatcggttgccgatggcaccgttgcc
acctggcacaaacaaccgggcgacgccgtcaagcgtgacgaactgatcgtcgacatcgaa
accgacaaagtcgtactggaagtgctggctaccgccgacggcgtgctgggcgcaatcgtc
aagggcgagggcgaaaccgtcctgtccgacgaagtcctgggctccatcgttgaaggcggc
gctgcatccgctgctccggctgccgctgctgctcctgccgctgccgccgctgcacctgct
gccgctgatggcgaagacgacccgatcgctgctcctgctgcgcgcaagctggctgaagag
aacggcatcaacatcgcttccgttgccggcaccggcaaaggcggtcgcgtgaccaaggaa
gacgtggttgcagccgttgctgccaagaaagccgctccggctgctgcgcctgccaaggct
gctgctccggccgccgccgctcctgtgttcgccgctggcgaccgcatcgagaagcgcgtt
ccgatgacccgcgttcgtgccaccgttgccaagcgtctggttgaagctcaatcgaacatg
gcgatgctgaccactttcaacgaagtcgacatgaccgaagtcatggccctgcgttcgaag
tacaaggatctgttcgagaagtcccacaacggcgtacgcctgggcttcatgtcgttcttc
gtgaaggctgccaccgaagcgctgaaacgcttcccggcggtcaacgcttcgatcgatggc
aacgacatcgtttaccacggttatgccgacatcggcgtcgctgtttccagcgaccgcggc
ctggtggttccggttctgcgtaacgccgaacacatgagcctggctgaaatcgaaggcggc
atcgccaccttcggcaagaaagcccgtgacggcaaactgtcgatggacgaaatgaccggc
ggtaccttcaccatcaccaacggtggtaccttcggttcgatgatgtcgaccccgatcgtc
aacccgccgcaggcagcgattctgggcatgcacaacatcatccagcgtccgatggccatc
aacggtcaggtcgtgatccgtccgatgatgtacctggcactgtcctacgatcaccgtctg
atcgatggcaaagaagctgtaaccttcctggtgaccatcaagaacctgctggaagatccg
gctcgtctgttgctggatatctga

DBGET integrated database retrieval system