KEGG   Pseudomonas fluorescens Pf0-1: Pfl01_1617Help
Entry
Pfl01_1617        CDS       T00283                                 

Definition
(GenBank) succinyl-CoA synthetase beta chain
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
pfo  Pseudomonas fluorescens Pf0-1
Pathway
pfo00020  Citrate cycle (TCA cycle)
pfo00640  Propanoate metabolism
pfo00660  C5-Branched dibasic acid metabolism
pfo01100  Metabolic pathways
pfo01110  Biosynthesis of secondary metabolites
pfo01120  Microbial metabolism in diverse environments
pfo01130  Biosynthesis of antibiotics
pfo01200  Carbon metabolism
Module
pfo_M00009  Citrate cycle (TCA cycle, Krebs cycle)
pfo_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:pfo00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Pfl01_1617
   00640 Propanoate metabolism
    Pfl01_1617
   00660 C5-Branched dibasic acid metabolism
    Pfl01_1617
Enzymes [BR:pfo01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Pfl01_1617
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A ATP-grasp OKR_DC_1_N
Motif
Other DBs
NCBI-ProteinID: ABA73360
UniProt: Q3KFU6
Position
1808878..1810044
Genome map
AA seq 388 aa AA seqDB search
MNLHEYQGKQLFAEYGLPVSTGFAVDTPEAAAEACDKIGGNEWVVKAQVHAGGRGKSGGV
KLVRSKEDAKAFAQQWLGKRLVTYQTDANGQPVTKILVESCTDIAKELYLGAVVDRSSRR
IVFMASTEGGVDIEKIAHDTPEKILKATIDPLVGAQPFQGRELAFQLGLEGKQVAQFAKI
FVGLAKLFKDHDLALLEVNPLVIKADGDLHCLDAKINIDANAMYRQPKLKTFHDPSQDDP
REAHAAKFELNYVALEGNIGCMVNGAGLAMGTMDIVNLHGGKPANFLDVGGGATKERVTE
AFKIILSDSNVAAVLVNIFGGIVRCDMIAEGIIGAVKEVGVKIPVVVRLEGNNAELGAKV
LAESGLNIIAATSLTDAAQQVVKAAEGK
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgaatcttcacgagtatcagggtaagcagctgttcgctgaatacggcctgccagtttcc
actggtttcgcagtagacaccccggaagcagcagcagaagcttgcgacaaaatcggcggc
aacgagtgggttgtcaaagcccaggttcacgccggtggtcgcggtaaatcgggcggcgtc
aagctggttcgcagcaaagaagacgccaaagccttcgcacagcagtggctgggcaagcgt
ctggtgacttaccagactgacgccaacggccagccagtcaccaagatcctggttgaatcg
tgcactgatatcgctaaagagctgtacctgggcgctgtcgttgaccgttcgagccgtcgc
atcgtgttcatggcttccaccgaaggtggcgtggacatcgagaaaatcgctcacgacact
ccagaaaaaattctgaaagccactatcgatccactggttggcgctcagccattccagggt
cgcgagctggcattccagctgggtctggaaggcaagcaggttgctcagttcgccaagatc
ttcgtaggtctggccaagctgttcaaggatcacgacctggctctgctggaagtgaacccg
ctggtgatcaaggctgacggcgatctgcactgcctggacgccaagatcaacatcgacgcc
aacgcaatgtaccgccagcctaagctgaagactttccacgatccgtcgcaggacgatccg
cgcgaagcgcacgctgccaagttcgaactgaactacgtagcactggaaggcaacatcggc
tgcatggtgaacggtgccggcctggccatgggtaccatggacatcgtcaacctgcacggc
ggcaagccagccaacttcctcgacgtaggtggtggtgctaccaaagaacgcgtaaccgaa
gctttcaaaatcattctgtccgacagcaatgtcgctgcagtactggttaacatcttcggc
ggcatcgttcgttgcgacatgattgccgaaggcatcatcggtgcagtgaaagaagtcggc
gtgaaaatcccggttgttgttcgtcttgaaggcaacaacgctgaactgggcgctaaagta
ctggcagaaagcggtttgaacatcatcgctgctaccagcctgaccgacgctgctcaacaa
gtcgttaaagctgcggagggcaagtaa

DBGET integrated database retrieval system