KEGG   Pseudomonas fluorescens Pf0-1: Pfl01_1654Help
Entry
Pfl01_1654        CDS       T00283                                 

Definition
(GenBank) putative glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
pfo  Pseudomonas fluorescens Pf0-1
Pathway
pfo00480  Glutathione metabolism
pfo00590  Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:pfo00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    Pfl01_1654
  Metabolism of other amino acids
   00480 Glutathione metabolism
    Pfl01_1654
Enzymes [BR:pfo01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     Pfl01_1654
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin Frankia_peptide
Motif
Other DBs
NCBI-ProteinID: ABA73397
UniProt: Q3KFQ9
Position
1843117..1843677
Genome map
AA seq 186 aa AA seqDB search
MLKRWCAVPALLMALTGLAQAADCPDLLQGSLPKLRAKESIDLCQRYADKPLVVINTASF
CGFAPQFEGLEALNQRYKAQGLEMLGVPSNDFKQESKDSAETAKVCYANYGVTFTMTEPQ
KVRGDDATHLFQVLARQSSAPKWNFYKYVIDRQGKVIANFSSLTKPDDPEFLAAIEKAIA
SQSLKP
NT seq 561 nt NT seq  +upstreamnt  +downstreamnt
atgctcaagcgctggtgtgctgttcccgcgttgctgatggcgttgaccggactggctcag
gccgcggattgtccggatctgttgcaaggttcgttgcccaagttgcgggccaaggaatcc
atcgacctgtgtcagcgttacgccgacaaaccgctggtagtgatcaacacggccagcttc
tgtggtttcgcgccgcagttcgaggggctggaggcgctcaatcagcgctacaaggcccag
ggcctggaaatgctcggcgtaccgtccaatgacttcaagcaggagtccaaggacagcgcc
gagaccgccaaggtctgctacgccaactacggcgtgacgttcaccatgaccgagccgcag
aaggttcggggtgacgatgcgactcacttgttccaggtgctggccaggcagagcagcgcg
ccgaagtggaatttctacaagtacgtcatcgaccgccagggcaaggtgattgccaacttc
tccagcctgaccaaaccggatgatccggaatttctggcagccatcgagaaagccattgcc
tcccagtcgctgaaaccctga

DBGET integrated database retrieval system