KEGG   Pseudomonas fluorescens Pf0-1: Pfl01_1654Help
Entry
Pfl01_1654        CDS       T00283                                 

Definition
glutathione peroxidase
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
pfo  Pseudomonas fluorescens Pf0-1
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:pfo00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    Pfl01_1654
  Metabolism of other amino acids
   00480 Glutathione metabolism
    Pfl01_1654
Enzymes [BR:pfo01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     Pfl01_1654
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1843117..1843677
Genome map
AA seq 186 aa AA seqDB search
MLKRWCAVPALLMALTGLAQAADCPDLLQGSLPKLRAKESIDLCQRYADKPLVVINTASF
CGFAPQFEGLEALNQRYKAQGLEMLGVPSNDFKQESKDSAETAKVCYANYGVTFTMTEPQ
KVRGDDATHLFQVLARQSSAPKWNFYKYVIDRQGKVIANFSSLTKPDDPEFLAAIEKAIA
SQSLKP
NT seq 561 nt NT seq  +upstreamnt  +downstreamnt
atgctcaagcgctggtgtgctgttcccgcgttgctgatggcgttgaccggactggctcag
gccgcggattgtccggatctgttgcaaggttcgttgcccaagttgcgggccaaggaatcc
atcgacctgtgtcagcgttacgccgacaaaccgctggtagtgatcaacacggccagcttc
tgtggtttcgcgccgcagttcgaggggctggaggcgctcaatcagcgctacaaggcccag
ggcctggaaatgctcggcgtaccgtccaatgacttcaagcaggagtccaaggacagcgcc
gagaccgccaaggtctgctacgccaactacggcgtgacgttcaccatgaccgagccgcag
aaggttcggggtgacgatgcgactcacttgttccaggtgctggccaggcagagcagcgcg
ccgaagtggaatttctacaagtacgtcatcgaccgccagggcaaggtgattgccaacttc
tccagcctgaccaaaccggatgatccggaatttctggcagccatcgagaaagccattgcc
tcccagtcgctgaaaccctga

DBGET integrated database retrieval system