KEGG   Pseudomonas fluorescens Pf0-1: Pfl01_1725Help
Entry
Pfl01_1725        CDS       T00283                                 

Definition
acireductone dioxygenase, ARD
Orthology
K08967  
1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase [EC:1.13.11.53 1.13.11.54]
Organism
pfo  Pseudomonas fluorescens Pf0-1
Pathway
Cysteine and methionine metabolism
Metabolic pathways
Module
Methionine salvage pathway
Brite
KEGG Orthology (KO) [BR:pfo00001]
 Metabolism
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    Pfl01_1725
Enzymes [BR:pfo01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.53  acireductone dioxygenase (Ni2+-requiring)
     Pfl01_1725
    1.13.11.54  acireductone dioxygenase [iron(II)-requiring]
     Pfl01_1725
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1918494..1919099
Genome map
AA seq 201 aa AA seqDB search
MQCPTGLEEPDGKADTEECPMSSLSVYHVSSPEIPNKVLTHFEDIASTLAEQGVRFDRWQ
AAAKIQPGASQEEVIGAYKEQIDKLMTERGYITVDVISLNSDHPQKAELRAKFLEEHRHG
EDEVRFFVAGRGLFTLHIDDYVYAVLCEKNDLISVPAGTKHWFDMGENPHFVAIRLFNNP
EGWVANFTGEDIAGRFPRLED
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgcagtgcccgaccggtctcgaagaaccggacggcaaggccgataccgaggaatgcccc
atgagcagcctgtccgtctatcacgtttccagccccgagattccgaacaaggtgctgacc
catttcgaagacatcgcttcgaccctggccgagcagggcgtgcgcttcgaccgttggcaa
gccgccgcgaagatccagcccggcgccagccaggaagaagtgatcggtgcttataaagag
cagatcgacaaactgatgactgagcgcggctacatcacggtcgacgtgatcagcctcaac
agcgaccacccacaaaaagccgaattgcgcgccaagttcctcgaagaacatcggcatggc
gaagacgaagtacgcttcttcgttgccggtcgcggtctgtttaccctgcacatcgacgat
tacgtctacgccgtgctgtgcgagaagaacgacctgatttcggtgccggccggtaccaag
cattggttcgatatgggcgagaacccgcatttcgtggcgatccgtctgttcaacaaccct
gaaggctgggtcgccaacttcaccggcgaagacatcgccggtcgcttcccgcgtctggag
gactga

DBGET integrated database retrieval system