KEGG   Pseudomonas fluorescens Pf0-1: Pfl01_1725Help
Entry
Pfl01_1725        CDS       T00283                                 

Definition
acireductone dioxygenase, ARD
Orthology
K08967  
1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase [EC:1.13.11.53 1.13.11.54]
Organism
pfo  Pseudomonas fluorescens Pf0-1
Pathway
Cysteine and methionine metabolism
Metabolic pathways
Module
Methionine salvage pathway
Class
Metabolism; Amino acid metabolism; Cysteine and methionine metabolism [PATH:pfo00270]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1918494..1919099
Genome map
AA seq 201 aa AA seqDB search
MQCPTGLEEPDGKADTEECPMSSLSVYHVSSPEIPNKVLTHFEDIASTLAEQGVRFDRWQ
AAAKIQPGASQEEVIGAYKEQIDKLMTERGYITVDVISLNSDHPQKAELRAKFLEEHRHG
EDEVRFFVAGRGLFTLHIDDYVYAVLCEKNDLISVPAGTKHWFDMGENPHFVAIRLFNNP
EGWVANFTGEDIAGRFPRLED
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgcagtgcccgaccggtctcgaagaaccggacggcaaggccgataccgaggaatgcccc
atgagcagcctgtccgtctatcacgtttccagccccgagattccgaacaaggtgctgacc
catttcgaagacatcgcttcgaccctggccgagcagggcgtgcgcttcgaccgttggcaa
gccgccgcgaagatccagcccggcgccagccaggaagaagtgatcggtgcttataaagag
cagatcgacaaactgatgactgagcgcggctacatcacggtcgacgtgatcagcctcaac
agcgaccacccacaaaaagccgaattgcgcgccaagttcctcgaagaacatcggcatggc
gaagacgaagtacgcttcttcgttgccggtcgcggtctgtttaccctgcacatcgacgat
tacgtctacgccgtgctgtgcgagaagaacgacctgatttcggtgccggccggtaccaag
cattggttcgatatgggcgagaacccgcatttcgtggcgatccgtctgttcaacaaccct
gaaggctgggtcgccaacttcaccggcgaagacatcgccggtcgcttcccgcgtctggag
gactga

DBGET integrated database retrieval system