KEGG   Pseudomonas fluorescens Pf0-1: Pfl01_1740Help
Entry
Pfl01_1740        CDS       T00283                                 

Definition
3-hydroxyacyl-CoA dehydrogenase (EC:1.1.1.35 4.2.1.17)
Orthology
K01782  
3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
pfo  Pseudomonas fluorescens Pf0-1
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Tryptophan metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Biosynthesis of unsaturated fatty acids
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Fatty acid metabolism
Module
beta-Oxidation
Brite
KEGG Orthology (KO) [BR:pfo00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Pfl01_1740
   01212 Fatty acid metabolism
    Pfl01_1740
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Pfl01_1740
   00650 Butanoate metabolism
    Pfl01_1740
  Lipid metabolism
   00071 Fatty acid degradation
    Pfl01_1740
   01040 Biosynthesis of unsaturated fatty acids
    Pfl01_1740
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Pfl01_1740
   00310 Lysine degradation
    Pfl01_1740
   00380 Tryptophan metabolism
    Pfl01_1740
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Pfl01_1740
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Pfl01_1740
   00281 Geraniol degradation
    Pfl01_1740
  Xenobiotics biodegradation and metabolism
   00930 Caprolactam degradation
    Pfl01_1740
Enzymes [BR:pfo01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     Pfl01_1740
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     Pfl01_1740
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     Pfl01_1740
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1932130..1934274
Genome map
AA seq 714 aa AA seqDB search
MTQAIRYEKGQDGIVLLTIDMPGQSANTMNAVYREAMADSVARLLAEKDDIAGVIITSAK
KTFFAGGDLNELIKVGKPEAKAFYDMVLTLKGQLRTLETLGKPVVAAINGAALGGGWEIC
LACHHRVALDDASVQLGLPEVTLGLLPGGGGVVRMVRMLGIEKALPYLLEGKKVRPQQAL
QAGLIDELAADRDELLAKARAWILANPAAVQRWDVKGYQIPGGTPSNPKVAQMLAIAPSI
LRTKTQGTLPAPEKILCAAVEGAQVDFDTAHLIETRYFTVLTTGQISKNLIGTFWFQLNE
INAGGSRPQGFAPYVTKRVGVLGAGMMGAGIAYVSAVAGIDVVLKDINLAAAEKGKAHSA
ALLDKKVARGQMSAQQREAVLARIQPTESDADLAGCDLIIEAVFEDRQLKAKVSAAAQQV
VGADAVIASNTSTLPITGLATAVPDQSKFIGLHFFSPVEKMPLVEIIKGAQTSDETLARG
FDFVLQIKKTPIVVNDSRGFFTSRVFGTFTNEGIAMLGEGVSAPMIETEARKAGMPVGPL
AISDEVSLSLMSHIRQQTAKDLQAEGKALIEHPAFAVIDLLLNEYKRPGKAAGGGFYEYP
AGGQKHLWPELKTRFEKADGQISPKDVRDRLLFVQAIETVRCVEEGVLTSTADANVGSIF
GIGFAAWTGGALQFINQYGVKDFVARAQYLAEQYGERFAPPALLLEKAAKGELF
NT seq 2145 nt NT seq  +upstreamnt  +downstreamnt
atgacccaagccattcgttacgaaaaaggccaggacggcatcgtcctcctgaccatcgac
atgccgggccagagcgccaacaccatgaacgcggtgtaccgcgaggccatggccgacagc
gtcgcccgactgctggcggaaaaagatgacatcgccggggtgatcatcacttcggccaag
aaaaccttcttcgccggtggcgacctgaatgaactgatcaaggtcggcaagcccgaagcc
aaggccttctacgacatggtgctgaccctcaagggccagttgcgcaccctggaaaccctc
ggcaaaccggtggtcgcggcgatcaacggcgcggcactcggcggtggctgggaaatctgc
ctggcctgccaccaccgcgttgcgttggacgatgcgtcggtgcaactcggtttgccggaa
gtgaccctcggtttattaccgggcggcggcggagttgtgcgcatggtgcgcatgcttggc
atcgaaaaggctttgccgtatctgcttgaaggcaagaaagtccgtccgcagcaggcgttg
caggcaggtttgatcgatgaactggcggcggatcgcgatgagctgctggccaaggcccgg
gcgtggattctggccaatcctgcggccgtgcagcgttgggatgtgaagggttatcagatt
cccggcggcacgccatccaatccgaaagttgcgcagatgctggcgattgcgccgtcgatc
ctgcgcaccaaaacccaaggcacgttgccggcaccggagaagattctttgcgcggcggtg
gagggcgcgcaggtggatttcgacacggcgcacctgatcgaaacccgctactttaccgta
ctgaccaccggccagatctcgaaaaacctgatcggcaccttctggtttcagctcaatgaa
atcaatgccggcggttcgcggccgcagggttttgcgccttatgtgacgaagcgtgtgggc
gtgcttggcgccggaatgatgggggcgggaatcgcgtacgtcagcgctgtggccggaatc
gatgtggtgctcaaggacatcaaccttgctgctgccgaaaagggcaaggcgcattcggcg
gcgctgctggataaaaaagtcgctcgtgggcaaatgtctgcgcagcagcgtgaagcggtg
ctggcgcgtatccagccgaccgaaagcgatgccgatctggcaggttgcgatctgatcatc
gaggcggtgttcgaggatcgtcagctcaaggccaaggtctcggcggcagcgcaacaggtg
gtcggcgccgatgctgtgattgcttccaacacctcgaccttgccaatcactggcttggcg
actgcggtaccggatcaaagcaagttcatcggcctgcacttctttagcccggtggaaaag
atgccgctggtggaaatcatcaagggcgcacaaaccagcgacgaaaccctcgcacgcggg
ttcgatttcgtactgcaaatcaagaaaactccgattgtggtcaacgacagtcgcggcttc
ttcacgtcgcgagtattcggcacctttaccaatgaaggtattgcgatgctgggtgagggc
gtcagtgcgccgatgatcgagaccgaagcgcgcaaggccgggatgcctgtcgggccgctg
gcgatctctgacgaagtttccctcagcctgatgagccatatccgtcagcaaacggccaaa
gaccttcaagcagaagggaaagcgctgattgagcacccggcgttcgccgtgattgacctg
ctgctcaacgaatacaagcggccgggcaaggcagcgggaggcggtttttatgagtacccg
gcgggtgggcaaaaacatctgtggcccgaactgaaaacccgtttcgagaaagccgacggg
cagatttcgccgaaagatgtgcgtgaccggttgctgttcgtgcaggccatcgaaaccgtg
cgttgcgtggaggagggtgtactgacgtcgacggcggacgccaacgtcggctcgatcttc
ggcatcggttttgcggcatggacgggcggcgcgttgcagttcatcaaccaatatggcgtg
aaggactttgtcgcccgggcgcagtacctggcggagcagtacggtgagcgtttcgcaccg
cctgcgctgctgctggaaaaagccgcgaagggcgaattgttctaa

DBGET integrated database retrieval system