KEGG   Pseudomonas fluorescens Pf0-1: Pfl01_1801Help
Entry
Pfl01_1801        CDS       T00283                                 

Gene name
ligA
Definition
NAD-dependent DNA ligase LigA (EC:6.5.1.2)
Orthology
K01972  
DNA ligase (NAD+) [EC:6.5.1.2]
Organism
pfo  Pseudomonas fluorescens Pf0-1
Pathway
DNA replication
Base excision repair
Nucleotide excision repair
Mismatch repair
Brite
KEGG Orthology (KO) [BR:pfo00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    Pfl01_1801 (ligA)
   03410 Base excision repair
    Pfl01_1801 (ligA)
   03420 Nucleotide excision repair
    Pfl01_1801 (ligA)
   03430 Mismatch repair
    Pfl01_1801 (ligA)
Enzymes [BR:pfo01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.2  DNA ligase (NAD+)
     Pfl01_1801 (ligA)
DNA replication proteins [BR:pfo03032]
 Prokaryotic Type
  DNA Replication Elongation factors
   Elongation factors (bacterial)
    Other elongation factors
     Pfl01_1801 (ligA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2010582..2012939
Genome map
AA seq 785 aa AA seqDB search
MTAAKDRILELRAELDQHNYRYHVLDEPSIPDAEYDRLFHELKALEAANPELITSDSPTQ
RVGSVALTAFTQVRHEVPMLSLGNAFEETDMREFDRRVTEGLDLPAGDLFGGGAAVEYSC
EPKLDGLAVSLLYQDGVLVRGATRGDGTTGEDISVNVRTVRNIPLKLHGTGWPATLEVRG
EVFMSKAGFERLNASQLEVGGKTFANPRNAAAGSLRQLDSKITANRPLEFCCYGIGQVSH
DISDTHIGNLQQLKAWGMPISHELKLAKGIGECLDYYRDIGERRNSLAYEIDGVVFKVNS
IADQRELGFRAREPRWAIAHKFPAMEELTELLDVEFQVGRTGAVTPVARLKPVKVAGVTV
ANATLHNMDEVARLGLMIGDTVIIRRAGDVIPQVVQVVMERRPEDARPVQIPESCPVCGS
HVERTQLVKRSKGKETISEGAVYRCVGRLACGAQLKQAIIHFVSRRAMDIEGLGDKSVEQ
LVDEGLVSSPADLYALKFEDIVDLEGFAEVSSNKLLAAIEDSKKPGLARFIYALGIPDVG
EETAKVLARSLGSLERVQQALPQVLTYLPDIGLEVAHEIHSFFEDAHNRQVITELLGHGL
QIQDQGELGAEFAASTTLGGFLDKLHIPSVGPGGAQKLADKFESLEGVMNADWLDMRQAL
PEKQANSVREFFALPEHRQLAEDAEKQLRDFGMHWQSEKKVVEGLPLAGETWVLTGKVEL
MSRDVAKEHLESLGAKVAGSVSAKTHCVVAGPGAGSKLTKANELGVKVMDEEAFIAFLKG
HGISA
NT seq 2358 nt NT seq  +upstreamnt  +downstreamnt
atgactgccgccaaagaccgcattctagagctgcgcgctgaactcgatcagcacaactac
cgttaccacgtcctcgatgagccgagcattccggatgccgagtacgaccggttgttccac
gagctcaaggcgctggaagcggccaacccggaactgatcaccagcgactcgccgacccag
cgcgtcggcagcgtggcgctgaccgcgttcacccaggtgcgtcacgaagtgccgatgctc
agcctcggcaacgccttcgaagaaaccgacatgcgcgagttcgaccgccgggtgaccgaa
ggtctggatctgccggccggcgatctgttcggtggtggcgcggcggtggaatacagctgc
gagccgaaactcgatggtctggcggtcagcctgctgtatcaggacggcgtgctggtgcgc
ggtgccacgcgcggcgacggcaccaccggcgaagacatcagcgtcaacgtgcgcaccgtg
cgcaacattccgctgaagctgcacggcacgggctggccggcgaccctggaagtgcgtggc
gaagtgttcatgtccaaggccggtttcgaacgcctcaacgcttcgcaactggaagtcggc
ggcaagactttcgccaacccgcgcaacgccgccgccggcagcctgcgtcagctggattcg
aagatcaccgccaaccggccgctggaattctgctgctacggcatcggccaggtgtcccac
gatatttccgacacccacatcggcaacctccagcaactgaaagcctggggcatgccgatc
agccacgaattgaaactggccaagggcatcggcgaatgcctggattattaccgcgatatc
ggtgagcgccgtaattcgctggcctatgaaatcgacggcgtggtgttcaaggtaaacagc
attgccgaccagcgcgaactgggcttccgcgcccgtgaaccgcgctgggccatcgcccac
aaattcccggccatggaagagctcaccgagctgctcgacgtggagttccaggtcggccgt
accggcgccgtcacccctgtggcgcgcttgaaaccggtcaaggtcgctggcgtcacggtg
gccaacgccacattgcacaacatggatgaagtcgcccggctgggcctgatgatcggcgac
acggtgatcattcgtcgcgctggcgatgtgatcccgcaagtggtgcaagtggtcatggag
cgccgcccggaagatgcgcggccggtgcagattcctgagagctgcccggtctgcggctcc
cacgtcgaacgcacgcaactggtcaagcgcagcaagggcaaggaaaccatcagcgagggc
gcggtgtatcgctgcgtcggccgactggcctgcggtgcgcaactgaagcaggcgatcatt
cacttcgtctcccgtcgtgcgatggacatcgaaggcctgggcgacaagagtgtcgagcag
ttggtcgatgaggggctggtcagttcgccggctgatctttatgcgctgaagttcgaggac
atcgtcgacctcgagggctttgccgaggtgtcgagcaacaagttgctggctgcgattgaa
gacagcaagaaaccgggtctggcgcgcttcatctatgcgctgggcattccagatgtcggc
gaagagacggccaaggtgctggcgcgttcgctggggtcgctggagcgtgttcagcaagcc
ttgccgcaagtgctgacttacctgccggacatcggtctggaagtggcgcacgagattcac
agcttcttcgaagatgcgcacaaccggcaggtgatcaccgagctgctgggccacggtttg
cagattcaggatcagggcgagctgggcgccgagtttgccgccagcaccacgctgggtggc
ttcctcgacaagctgcacattccctcggtgggcccgggcggggcgcagaagctggcggac
aagttcgaatcgctggaaggggtgatgaatgcggactggctggacatgcgccaggcattg
ccggagaagcaggccaactcggttcgcgagttcttcgccttgccagaacatcgtcaactg
gctgaagacgccgagaagcaactgcgcgatttcggtatgcactggcagagcgaaaagaaa
gtcgtcgaaggcctgccattggccggggagacctgggtactgaccggcaaggtcgagctg
atgagccgcgacgtggccaaggaacacctggaaagcctcggcgccaaggtcgccggctcc
gtgtcggccaagactcattgcgtggtcgccgggccgggcgccgggtcgaaactgaccaag
gccaacgaactgggcgtgaaagtgatggatgaagaggcgtttatcgcgttcctgaaagga
cacggtatttccgcctga

DBGET integrated database retrieval system