KEGG   Pseudomonas fluorescens Pf0-1: Pfl01_1808Help
Entry
Pfl01_1808        CDS       T00283                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
pfo  Pseudomonas fluorescens Pf0-1
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:pfo00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Pfl01_1808 (recR)
DNA repair and recombination proteins [BR:pfo03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      Pfl01_1808 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2021222..2021824
Genome map
AA seq 200 aa AA seqDB search
MSFSPLIRQLIDALRTLPGVGQKTAQRMALQLLERDRSGGTRLAQALSQAMEGVGHCRQC
RTLTEDDLCPQCADTRRDDTLLCVVEGPMDVYAVEQTGFRGRYFVLKGHLSPLDGLGPEA
IGIPQLMARIEEAGTFTEVILATNPTVEGEATAHYIAQLLQNKGLIASRIAHGVPLGGEL
ELVDGGTLAHSFAGRKPISL
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atgagcttcagccctttgattcgccaactgatcgacgccctgcgaactttgccgggcgtg
ggtcagaaaactgcccagcgtatggcgttgcagttgctcgaacgtgaccgcagcggcggt
acgcgcctggcccaggccttgagccaagccatggaaggggtcggacactgccgccagtgc
cgcacgttgaccgaagacgatctgtgcccgcaatgcgccgacacccgtcgcgacgacacg
ctactgtgcgtggtggaagggccgatggacgtctacgcggtcgagcagaccggcttccgt
ggtcgctacttcgtgctcaaggggcacctatcgccgctggacggcctgggcccggaagcc
atcggcattccgcaattgatggcgcggatcgaagaggcgggcaccttcaccgaagtcatc
ctcgccaccaacccgaccgtggagggtgaagcaaccgcccactacatcgcccagttgctg
cagaacaaaggcctgatcgcctcgcgcatcgcccacggcgtgccgttgggcggcgaactg
gagctggtggacggcggcacgctggctcactcgtttgccgggcgcaagccgatttccctc
tga

DBGET integrated database retrieval system