KEGG   Pseudomonas fluorescens Pf0-1: Pfl01_1923Help
Entry
Pfl01_1923        CDS       T00283                                 

Definition
ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
pfo  Pseudomonas fluorescens Pf0-1
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:pfo00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Pfl01_1923
Enzymes [BR:pfo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     Pfl01_1923
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2195658..2196575
Genome map
AA seq 305 aa AA seqDB search
MSANVVVIGSLNMDLVTRAPRLPRGGETLIGHSFATVSGGKGANQAVAAARLGAQVSMVG
CVGNDEYGVQLHDALLAEQIDCQAVSVVEDSSGVALIVVDDNSQNAIVIVAGANGSMTPA
VIDRFDAVLQAADVIICQLEIPDATVGHALKRGHELGKMVILNPAPASRPLPVDWFAAID
YLIPNESEAAALCGLPVDSLETAEKAAAHLISLGAGKVIITLGAQGSLFANGTGYQYFPA
PKVKAVDTTAAGDTFVGGFAAALAAGKTEDEAIRFGQVAAALSVTRAGAQPSIPTTSDVQ
AFKPA
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atgtccgcaaatgtagtggtaataggcagcctgaacatggacctggtcacccgggcgccg
cgcttgccccggggcggtgagacgctgatcggtcattccttcgcgaccgtgtccggtggc
aagggcgccaatcaggcggtggccgctgcgcgactgggtgcgcaagtgtcgatggtcggc
tgtgtcggcaacgatgaatatggcgtgcaattgcacgacgcgttgctggccgagcagatc
gattgccaggcggtcagcgtggtggaggattccagtggtgtggccttgatcgtggtcgat
gacaacagtcagaacgcgattgtcatcgttgccggcgccaatggttcgatgaccccggcg
gtcatcgaccggttcgacgccgtgctgcaggctgccgacgtgatcatctgccagctggaa
atccccgatgccacggtgggccatgcgctgaaacgcgggcatgaactgggcaagatggtc
atcctcaacccggcgccggccagtcgcccgctgccggtggactggtttgccgccatcgat
tacctgattcccaacgagagcgaggccgccgccctctgcggtttgccggtggactcgctg
gagaccgctgaaaaagccgcggcgcacctgatttcactgggcgccggcaaggtcatcatc
acgctgggcgctcaaggctctttgttcgccaacggtacgggttaccagtattttcctgca
cccaaagtgaaggctgtcgacaccaccgccgccggggacacttttgtcggcggatttgcc
gctgcactggcggccggcaaaaccgaggacgaggccattcgtttcgggcaggtcgctgcg
gccctgtcggttacccgggcaggtgcccagccgtccattcccaccacctccgacgtacag
gcattcaaacccgcatga

DBGET integrated database retrieval system