KEGG   Pseudomonas fluorescens Pf0-1: Pfl01_2297Help
Entry
Pfl01_2297        CDS       T00283                                 

Definition
(GenBank) putative GGDEF domain protein
  KO
K13590  
diguanylate cyclase [EC:2.7.7.65]
Organism
pfo  Pseudomonas fluorescens Pf0-1
Brite
Enzymes [BR:pfo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.65  diguanylate cyclase
     Pfl01_2297
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(2647887..2649488)
Genome map
AA seq 533 aa AA seqDB search
MPGRNTQAPTPDQAPRATRKGVKAGSTFRLTVSFMLMVVVAFLAVESWRTWRDYRSVFAS
ARDSVTNLARATAQHAEDTIRQVDVLTAGLAERVEGDGLQNLDVARIHKLLVQQSKIMPQ
LHGLFIYGPDGHWIVTDKEVTPETANNADRDYFQYHRTHEDRRVRIGQVVESRSTHDLII
PISRRLNNPDGSFAGVLLGTVKVSYFVDYYGDFRIDDKGALVLAMRDGTILVRRPFITSV
VGKSLANSEIFKTYLPNANQGIVQIRAVVDDTERLYGYRALTTYPLVVEAGLSRDSIVAP
WRQDLLKNGFVLVFLILVLACFGLIVLSQLRQRMAMEREIRSAHKTMRDMALTDSLTGLG
NRRRLDAALADEIRLARRQGSPLSLIMLDVDYFKRYNDQYGHAAGDDCLIAVGDGIRKAV
KRPSDLAVRYGGEEFTVLLPNTDSAGAIQVAEDILQTIRSLELEHAGHPLGYVTASAGIT
TRYPVDDAVTPATLLKAADTCLYQAKQQGRNRWCSAQASRQIQPIAAMPRTDR
NT seq 1602 nt NT seq  +upstreamnt  +downstreamnt
atgcccggacgcaacacgcaagcgcccacgccagatcaagcaccgcgcgcgacccgcaag
ggcgtgaaggccggctcgacctttcgcctgaccgtcagtttcatgctgatggtggtcgtg
gcttttctggcggtcgagagctggcggacgtggcgcgactatcgttcggtctttgcctcc
gcgcgtgattcggtgaccaaccttgctcgcgccacggcgcagcatgccgaggacaccatt
cgccaggtcgatgtgctgaccgccgggctggccgagcgtgtcgaaggcgatgggctgcag
aacctggatgtggcacgcattcacaagctgctcgttcagcagtcgaaaatcatgccgcag
ctgcacggcctgttcatctacggcccggacggccattggatcgtgaccgacaaggaggtc
acgcccgaaaccgccaacaacgctgaccgcgattatttccagtaccaccgcacccatgaa
gaccggcgcgtgcgcatcggtcaggtggtggagagccgttccacccatgacctgatcatt
ccgatctcgcgccgtttgaataaccccgacggctcgttcgccggcgttctgctggggacg
gtcaaggtcagttatttcgtcgattactacggtgatttccgtatcgacgacaaaggcgcg
ctggtgctggcgatgcgcgacggcacgatcctcgtgcgccggccgttcattacctcggtg
gtcggaaaaagcctggctaacagcgagatcttcaagacctacctgcccaacgccaaccag
ggcattgtccagatcagggcggtggtcgacgacaccgaacgcctttacggctatcgcgcc
ctgaccacctacccgctggtggtcgaggccggtttgtcccgggattccatcgttgcgccg
tggcgtcaggacctgctgaaaaacggcttcgtgctggtgttcctgattctggtgctggcc
tgtttcgggctcatcgtcttgagccagttgcgccagcggatggcgatggaacgggagatc
cgttccgcgcacaagaccatgcgcgacatggcgctgaccgacagcctcacaggcctcggc
aatcgccgtcgactggacgcggcgctggcggacgagattcgcctggcccggcgtcaaggt
tctccgctgtcattgatcatgctcgatgtcgactacttcaagcgctacaacgaccagtac
ggccatgccgctggcgacgactgcctgatcgcggtcggcgacggcatccgcaaagcggtc
aagcggccttcggacctggccgtgcgctacggcggcgaggaattcaccgtgctcctgccc
aacaccgacagcgccggagcgattcaggtggccgaagacattctgcagaccattcgctcg
ctggagcttgaacatgccgggcatccgctggggtatgtcactgcgagtgcggggatcacc
acgcgttatccggtggacgacgcggtgaccccggcgactttgctcaaggcggccgatacc
tgtctgtatcaggccaagcagcaagggcggaatcgctggtgctcggcgcaggcatcccgg
caaatccagccgattgcggcgatgccgcgcacggatcgctga

DBGET integrated database retrieval system