KEGG   Pseudomonas fluorescens Pf0-1: Pfl01_2313Help
Entry
Pfl01_2313        CDS       T00283                                 

Definition
L-threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
pfo  Pseudomonas fluorescens Pf0-1
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:pfo00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Pfl01_2313
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Pfl01_2313
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Pfl01_2313
Enzymes [BR:pfo01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Pfl01_2313
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2667282..2668550)
Genome map
AA seq 422 aa AA seqDB search
MKNSYREYVLQCLVCDRSYQPHEVSYFCPHCKVDGALDALYDYPTLRREWPKESLAHHQA
RGMWRYDRLMPLSSTQFIPPLLVGNTPLYAPTDLLGKGSRIKVLIKDESRQPTGSLKDRA
SALAVAHAMQSGARTVAVASTGNAASALAGMSASLGLHNVIYLPRSAPREKRAQMQGYGA
EIVLVDGQYDEAFEQCLNACERYGWYNRTTGINSYMSEGKKTVAFEICEQLHWQVPDLVF
VPVGNGCILGSVYKGFFDLLQLGWIERIPRLIGVQAEHSNFMYRAWRSDRPMQQTERIAP
TSLASSINVALPRDRLKAMRAVTASEGEFMCVSDASIVAAASKLAASTGVFPEAGAASAF
AGLLKYAEQHPDTAQTAVILITGSGLKDTSIFLSDTAASPSRVFPHHVPTTLTETLAQGI
TA
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atgaagaattcgtacagagagtatgtgttgcagtgtctggtgtgcgaccgcagctaccag
ccgcacgaggtcagttatttctgccctcattgcaaagtcgatggtgcccttgacgcgctt
tacgattacccgacgctcagacgtgaatggcccaaagaaagcctggcccaccaccaggcc
cgtggcatgtggcgctatgaccgactgatgccgttgagctcgacgcagttcattccgccg
ctactggtgggcaatacgccgctgtacgcaccgaccgatctgctcggcaaaggctcgcgg
atcaaggtcttgatcaaggatgaatcgcgccagcccaccgggtcgctgaaggatcgcgcc
agcgcgttggccgtggctcacgccatgcagtccggtgcgcgcaccgtggcggtggccagc
accggcaacgcggcttcggcactggccggaatgagtgccagtctgggcctgcacaacgtg
atctacctgccccgaagcgcaccccgtgaaaagcgcgcgcagatgcagggctacggcgcc
gagatcgtgctggtcgacggtcagtacgacgaagccttcgagcaatgcctcaacgcctgt
gaacgatacggctggtacaaccgcaccaccggcatcaattcgtacatgagcgaaggcaag
aaaaccgtcgccttcgagatctgcgaacaactgcactggcaggtgccggatctggtgttc
gtgcccgtcggcaatggctgcattctgggctcggtctacaagggtttcttcgacctgctg
caactgggctggatcgagcgcatcccgcgcctgatcggcgtgcaggccgagcacagcaac
ttcatgtaccgggcctggcgcagtgaccgaccgatgcagcagactgaacgcatcgccccc
accagcctggccagcagcatcaacgtggcgctgccccgcgaccggctcaaagccatgcgc
gcggtgaccgccagcgagggcgaattcatgtgtgtcagcgacgcgagcatcgtcgccgcc
gcatcgaagcttgccgccagcaccggcgtgtttcccgaagccggcgccgccagtgccttc
gccggcctgctgaagtacgccgaacaacaccccgacaccgcgcaaaccgccgtgatcctg
atcaccggcagcggcttgaaagacacctccatttttctctccgacacggccgcgagcccg
tcacgtgtgttccctcatcacgtgccgaccacgctgaccgaaacgcttgcacaaggaatc
accgcatga

DBGET integrated database retrieval system