KEGG   Pseudomonas fluorescens Pf0-1: Pfl01_2536Help
Entry
Pfl01_2536        CDS       T00283                                 

Definition
glycogen branching enzyme (EC:2.4.1.18)
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
pfo  Pseudomonas fluorescens Pf0-1
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pfo00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Pfl01_2536
Enzymes [BR:pfo01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     Pfl01_2536
Exosome [BR:pfo04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Pfl01_2536
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2901379..2903610
Genome map
AA seq 743 aa AA seqDB search
MSFSNREQGHAKERLLPTAKDIDALVRAEHHDPFSILGPHGDGAGGQFIRAYLPGALSVS
VVDKNSGEELGPLEATETPGLFVGHFEGSRPYLLRTRWAGGEQVAEDPYSFGQLLGEMDL
YLFAEGNHRDLSSCLGAQLKTVDGVDGVRFAVWAPNARRVSVVGDFNVWDGRRHPMRLRH
PSGVWELFIPRLQAGELYKYEILGAHGILPLKADPMALATSLPPDTASKVASPLQIDWQD
QDWMSGRRERQQHNAPLSIYELHAGSWQCELDDLGEVARQYTWPELAERLIPYVKELGFT
HIELMPIMEHPFGGSWGYQLLSQFAPSARYGTPEQFGEFVNACHQAGIGVILDWVPAHFP
TDTHGLAQFDGTALYEYGNPLEGFHQDWDTLIYNLGRTEVHGYMLASALHWLKHFHIDGL
RVDAVASMLYRDYSRKAGEWVPNRHGGRENLEAIDFLRHLNDVVALEAPGALVIAEESTA
WPGVSQSTQQGGLGFAYKWNMGWMHDSLHYIQQDPVYRAHHHNELSFGLVYAWSERFILP
ISHDEVVHGKHSLIDKMPGDRWQKFANLRAYLSFMWTHPGKKLLFMGCEFGQWREWNHDQ
QLDWYLLQYSEHKGVQKLVSDLNRLYREEPALHEQDDAPQGFQWLIGDDAINSVYAWLRW
SKDGTPVLVVANFTPVPRQSYRVGVPFAGRWKELLNSDADTYAGSNYGNGGGAFTEEVAS
HGQALSLELNLPPLAVLILKPEV
NT seq 2232 nt NT seq  +upstreamnt  +downstreamnt
atgagtttctcgaacagggaacagggtcacgctaaagaaagattgctgcccactgcaaaa
gacattgatgctttagtgcgcgcagaacaccacgacccgttttccattcttggcccccac
ggcgatggtgccggcgggcaatttatccgggcgtatctgcccggcgcattgagtgtttct
gtcgtcgataaaaacagtggcgaagagctcggtccgctggaggccaccgaaacgccgggg
ctgtttgtcgggcatttcgaaggctcacggccgtacctgttgcgcacccgctgggccggt
ggtgaacaggtcgcggaagatccttacagctttggtcagttgctcggtgaaatggatttg
tatctgttcgccgaaggcaaccatcgcgatctcagcagttgccttggcgcgcagctgaaa
accgtcgatggcgtcgacggtgtgcgctttgccgtgtgggcaccgaatgcccggcgggtg
tcggtggtcggcgatttcaacgtctgggacgggcggcggcatccgatgcgcttgcggcat
ccatccggggtctgggagctgttcattccacgcttgcaggcgggcgagctgtacaaatac
gaaatcctcggcgcccacggcatcctcccgctcaaagccgacccgatggcgctggccacc
agcctgccgccggacacggcctcgaaagtcgcctcgccgttgcagatcgactggcaggat
caggactggatgagcggccgtcgcgaacgccagcaacacaacgcgccgttgtcgatctat
gaattgcacgccggatcctggcaatgcgaactcgacgatctgggcgaagtggcgcgccag
tacacctggccggagctcgccgagcggctgattccctacgtgaaggaactgggtttcacc
cacatcgaactgatgccgatcatggagcacccgttcggcggttcatggggctatcagttg
ctgtcgcagttcgctccgagtgcgcgatacggcacacccgagcagttcggcgagttcgtc
aatgcctgtcaccaggccggcatcggtgtgattctcgactgggtgccggcgcatttcccg
accgatacccatggccttgcgcaattcgacggcaccgcgctctacgaatacggtaatcca
ctggaaggcttccaccaggattgggacacgctgatctacaacctgggccgcaccgaagtg
cacggctacatgctggcgtcggcgttgcactggctcaagcatttccatatcgacgggctg
cgggtcgatgcggtggcgtcgatgctctatcgtgattattcgcgcaaggccggcgagtgg
gtgccgaaccgtcatggcggtcgcgagaacctggaagccatcgatttcctgcggcacttg
aacgacgtggtggcactggaagcaccgggcgcactggtgattgccgaggagtccacggcg
tggccgggcgtcagccagagcacccaacagggcggtctcggtttcgcctacaaatggaac
atgggctggatgcacgactcgctgcactacattcagcaggatccggtgtaccgcgcccat
caccacaacgagttgagtttcggcctggtctacgcctggtccgagcgcttcatcctgccg
atttcccacgacgaagtggtgcacggcaagcattcgctgatcgacaagatgcctggcgat
cgctggcagaaatttgccaacctgcgggcttacctgagtttcatgtggacccatccgggc
aagaagctgttgttcatgggttgcgagttcggccagtggcgcgagtggaatcatgatcag
cagctggactggtatctgctgcaatattcggaacacaaaggcgtgcagaaactggtcagc
gacctcaatcggttgtaccgcgaagagccggcgctgcatgagcaggacgatgcgccgcaa
gggtttcagtggttgatcggcgacgatgcgatcaacagcgtctatgcgtggctgcgctgg
agcaaggacggcacgccagtgctggtggtggccaacttcaccccggtgccgcgtcagtct
taccgcgtgggcgtgccgtttgccgggcgctggaaggagttgctcaacagtgacgccgac
acgtatgccggttccaattatggcaacgggggcggggcgttcaccgaagaggtggccagc
catggccaggcgttgtcgctggagctgaacctgccgccgctggcggtgttgatcctcaaa
cccgaagtctga

DBGET integrated database retrieval system