KEGG   Pseudomonas fluorescens Pf0-1: Pfl01_2576Help
Entry
Pfl01_2576        CDS       T00283                                 

Definition
agmatinase (EC:3.5.3.11)
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
pfo  Pseudomonas fluorescens Pf0-1
Pathway
Arginine and proline metabolism
Metabolic pathways
Module
Polyamine biosynthesis, arginine => agmatine => putrescine => spermidine
Brite
KEGG Orthology (KO) [BR:pfo00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Pfl01_2576
Enzymes [BR:pfo01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     Pfl01_2576
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2953591..2954550
Genome map
AA seq 319 aa AA seqDB search
MDVPMQNDQALTRDSLFGTAAESTYAGITSFMRRRYSRDLRGADVAVSGVPFDTATSNRP
GARFGPRGIRAASTGIAWERHWPWAFDPFDHLAVIDYGDCDFDYGSPHTIPDSIEAHAEH
ILSSGSAMLTFGGDHFISYPLLKAHARKHGTLSLIHFDAHSDTWPDEGGKRVDHGTMFWH
AAREGLVDPARSVQIGLRTTNDDHQGFQVLDARQVHRCGCEAIIEAIRARVGDNPVYLTF
DIDCLDPAFAPGTGTPVCGGLSTVQALEILGGLRGINLVGMDVVEVAPAYDHADVTSLAA
ATLAMEMLCLYAARHKVDA
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atggacgtgcccatgcaaaacgatcaggccctgacccgtgacagcctttttggcaccgct
gctgaaagcacctacgccgggatcaccagtttcatgcgccggcgctacagccgcgacctg
cgcggcgcggacgtggcggtcagcggtgtgccgttcgacaccgccaccagcaaccgtccg
ggcgcccgtttcgggccgcgcgggattcgtgcggcgtccaccgggattgcctgggaacgg
cactggccatgggcgttcgacccgttcgatcatctggcggtgatcgactacggcgattgc
gacttcgattacggctcgccgcacaccatcccggacagcatcgaggcccacgccgagcat
attctcagctccggcagcgccatgctcacctttggcggcgaccatttcatcagctatccg
ctgctcaaggcccatgcacgcaagcacggcacgctgtcgctgatccacttcgatgcgcac
agcgatacctggccggacgagggtggcaagcgggtcgatcacggcaccatgttctggcac
gcggcgcgggaagggctggtggatccggcgcgttcggtgcagatcggcttgcgcaccacc
aatgacgatcatcagggctttcaggtgctggacgcgcggcaggtgcatcggtgtggatgc
gaggcgatcatcgaggcgattcgcgcgcgggtcggggataacccggtgtacctgacgttc
gacatcgattgcctcgacccggccttcgcaccgggcaccgggaccccggtgtgcggcggg
ttgagcacggtgcaggcgctggagatccttggcggcctgcgcgggatcaatctggtgggc
atggacgtggtggaagtggccccggcttacgaccacgcggacgtgacgtcgctggcggcg
gcaaccctggccatggagatgctttgcctgtacgcggcccggcacaaagtcgacgcgtga

DBGET integrated database retrieval system