KEGG   Pseudomonas fluorescens Pf0-1: Pfl01_2648Help
Entry
Pfl01_2648        CDS       T00283                                 

Definition
CheB methylesterase (EC:3.1.1.61)
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
pfo  Pseudomonas fluorescens Pf0-1
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:pfo00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Pfl01_2648
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    Pfl01_2648
Enzymes [BR:pfo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     Pfl01_2648
Two-component system [BR:pfo02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   Pfl01_2648
Bacterial motility proteins [BR:pfo02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    Pfl01_2648
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3035706..3036299
Genome map
AA seq 197 aa AA seqDB search
MNSAADLPRVEAIVVGASAGGVEALLTMLGSLRAGFGLPIIIVLHLPEERRSQLAEVFAR
RVALPVAEAIDKQDITPGTVYFATPGYHLSVEQDFSLSLSLEDRLHHSRPSIDFLFESAA
DAYGPALAAVLLTGANHDGARGLAQVKRLGGLTIVQDPDEAQVATMPRAALKTHQPDYIL
PIHGIGRLLVELERIAC
NT seq 594 nt NT seq  +upstreamnt  +downstreamnt
atgaacagtgcagcggatttgcctcgggtcgaggcgattgtggtcggagcttccgccggt
ggcgtcgaggctttgttgacgatgctcggttccttgagggccgggttcggactgccgatc
attatcgtgctgcatctgccggaagagcgccgcagtcagctcgccgaggtgtttgcccgg
cgagtggcgctgccggtggcagaagccatcgacaagcaggacatcacaccgggcaccgtg
tacttcgcgacgccgggttatcacctgtcggtggagcaggacttcagcctgtcgctgagc
cttgaagaccgcctgcatcattcgcggccttcgatcgacttcctgttcgaatccgccgcc
gatgcctacgggccggcgctggccgccgtgttgctgaccggcgccaaccacgatggcgcg
cggggcctggcgcaagtcaaacgcctgggcggcctgaccatcgtgcaggaccccgacgag
gcgcaggtcgccaccatgcctcgcgcggcactgaaaacgcatcaaccggattacatactt
cccatacacggcatcggccgtctgcttgtcgagctggaacgaatcgcatgctga

DBGET integrated database retrieval system