KEGG   Pseudomonas fluorescens Pf0-1: Pfl01_2929Help
Entry
Pfl01_2929        CDS       T00283                                 

Definition
UDP-glucose pyrophosphorylase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
pfo  Pseudomonas fluorescens Pf0-1
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:pfo00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Pfl01_2929
   00052 Galactose metabolism
    Pfl01_2929
   00500 Starch and sucrose metabolism
    Pfl01_2929
   00520 Amino sugar and nucleotide sugar metabolism
    Pfl01_2929
Enzymes [BR:pfo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Pfl01_2929
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3375159..3375998)
Genome map
AA seq 279 aa AA seqDB search
MIKKCLFPAAGYGTRFLPATKAMPKEMLPVVNKPLIQYGVEEALDAGLNEISIVTGRGKR
ALEDHFDISYELENQIKGTDKEKYLVGIRKLLDECSFSYTRQTEMKGLGHAILTGRPLIG
DEPFAVVLADDLCVNLEGDGVLTQMVKLYKQFRCSIIAIQEVDPQETSKYGVIAGEMIRD
DIYRVHSMVEKPKPEDAPSNLAIIGRYILTPDIFDLIEQTEPGKGGEIQITDALMKQAQN
GCVMAYKFKGKRFDCGGAEGYIEATNFCFENFYKTGKAY
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
atgatcaagaaatgcttgttcccagcagccggttacggtactcgcttcctcccagcgact
aaggccatgcccaaagaaatgctgccggtggtaaacaagccactgatccagtacggcgtc
gaagaagctctggatgctggcctgaacgaaatctccatcgtgaccggccgtggcaagcgc
gccctggaagaccacttcgatatcagctatgagctggaaaaccagatcaaaggcaccgac
aaggaaaaatacctggtcggtatccgcaagctgctggacgagtgctcgttctcctacacc
cgtcagaccgaaatgaaaggcctgggccacgcgatcctgaccggccgcccgctgatcggt
gacgagccgttcgccgtggtgctggcggacgacctgtgcgtcaaccttgaaggcgacggc
gtgctgacccagatggtcaagctgtacaagcagttccgctgctcgatcattgccatccag
gaagtcgatccgcaggaaaccagcaagtacggcgtgatcgctggcgaaatgatccgcgac
gacatctaccgcgtacacagcatggtcgagaagccaaagccggaagacgcaccgtcgaac
ctggcgatcatcggccgttacatcctgaccccggacatcttcgacctgatcgaacagacc
gagccaggcaagggaggtgaaatccagatcaccgacgccctgatgaagcaagcccagaac
ggctgcgtgatggcctacaagttcaagggcaagcgtttcgactgcggtggtgctgaaggc
tacatcgaagcaaccaacttctgcttcgagaacttctacaagactggcaaggcttactga

DBGET integrated database retrieval system