KEGG   Pseudomonas fluorescens Pf0-1: Pfl01_3079Help
Entry
Pfl01_3079        CDS       T00283                                 

Definition
3-hydroxybutyrate dehydrogenase (EC:1.1.1.30)
Orthology
K00019  
3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
pfo  Pseudomonas fluorescens Pf0-1
Pathway
Synthesis and degradation of ketone bodies
Butanoate metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:pfo00650]
Metabolism; Lipid metabolism; Synthesis and degradation of ketone bodies [PATH:pfo00072]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3523882..3524655
Genome map
AA seq 257 aa AA seqDB search
MTTLSGKTALVTGSTSGIGLGIALTLAKAGANLILNGFGDASKVIAEVEQFGGKVGHHPA
DVSDPAQIADMIAYAEREFGGVDILVNNAGIQHVAAVEEFPVERWDSIIAINLSSVFHST
RLSLPGMRAKGWGRIVNIASVHGLVGSTGKAAYVAAKHGVIGLTKVVGLETAASNVTCNA
ICPGWVLTPLVQKQIDDRAAKGVDPQQAQHDLLAEKQPSLEFVTPAHLGELVLFLCSEAG
SQVRGAAWNIDGGWLAQ
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atgacgactctttctggcaagaccgcactggttaccggctccaccagcggaatcgggctg
ggcatcgccctgacgctggccaaggctggcgccaacctgatcctaaacggctttggcgac
gcctccaaggtgatcgccgaagtcgagcagttcggcggcaaggtcggccatcacccggcg
gacgtcagcgatcccgcccagatcgccgacatgattgcctacgccgaacgcgagttcggc
ggcgtggacattctggtcaacaacgccggcatccagcacgtcgcggcggtggaagaattt
ccggtggagcgctgggattcgatcatcgcgatcaacctgtcgtcggtgtttcacagcact
cgcctgagtttgccgggcatgcgcgccaagggctgggggcgaatcgtcaacatcgcctcg
gtgcatggtctggtcggttccaccggcaaagccgcgtacgtggcagccaagcatggggtg
atcggcttgaccaaagtggtcggcctggaaaccgccgccagcaacgtcacctgcaacgcc
atctgcccgggctgggtgctgacgccgctggtgcagaagcagatcgatgatcgcgcagcc
aagggtgtcgacccgcagcaggcgcaacacgatctgctggccgaaaagcagccgtcgctg
gagttcgtcacgccggcgcatctgggtgaactggtgctgttcctgtgcagcgaggccggc
agccaggtgcgtggcgccgcgtggaatatcgatggcgggtggctcgcgcagtaa

DBGET integrated database retrieval system