KEGG   Pseudomonas fluorescens Pf0-1: Pfl01_3079Help
Entry
Pfl01_3079        CDS       T00283                                 

Definition
3-hydroxybutyrate dehydrogenase (EC:1.1.1.30)
Orthology
K00019  
3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
pfo  Pseudomonas fluorescens Pf0-1
Pathway
Synthesis and degradation of ketone bodies
Butanoate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pfo00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    Pfl01_3079
  Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    Pfl01_3079
Enzymes [BR:pfo01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.30  3-hydroxybutyrate dehydrogenase
     Pfl01_3079
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3523882..3524655
Genome map
AA seq 257 aa AA seqDB search
MTTLSGKTALVTGSTSGIGLGIALTLAKAGANLILNGFGDASKVIAEVEQFGGKVGHHPA
DVSDPAQIADMIAYAEREFGGVDILVNNAGIQHVAAVEEFPVERWDSIIAINLSSVFHST
RLSLPGMRAKGWGRIVNIASVHGLVGSTGKAAYVAAKHGVIGLTKVVGLETAASNVTCNA
ICPGWVLTPLVQKQIDDRAAKGVDPQQAQHDLLAEKQPSLEFVTPAHLGELVLFLCSEAG
SQVRGAAWNIDGGWLAQ
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atgacgactctttctggcaagaccgcactggttaccggctccaccagcggaatcgggctg
ggcatcgccctgacgctggccaaggctggcgccaacctgatcctaaacggctttggcgac
gcctccaaggtgatcgccgaagtcgagcagttcggcggcaaggtcggccatcacccggcg
gacgtcagcgatcccgcccagatcgccgacatgattgcctacgccgaacgcgagttcggc
ggcgtggacattctggtcaacaacgccggcatccagcacgtcgcggcggtggaagaattt
ccggtggagcgctgggattcgatcatcgcgatcaacctgtcgtcggtgtttcacagcact
cgcctgagtttgccgggcatgcgcgccaagggctgggggcgaatcgtcaacatcgcctcg
gtgcatggtctggtcggttccaccggcaaagccgcgtacgtggcagccaagcatggggtg
atcggcttgaccaaagtggtcggcctggaaaccgccgccagcaacgtcacctgcaacgcc
atctgcccgggctgggtgctgacgccgctggtgcagaagcagatcgatgatcgcgcagcc
aagggtgtcgacccgcagcaggcgcaacacgatctgctggccgaaaagcagccgtcgctg
gagttcgtcacgccggcgcatctgggtgaactggtgctgttcctgtgcagcgaggccggc
agccaggtgcgtggcgccgcgtggaatatcgatggcgggtggctcgcgcagtaa

  All links  
No link information was found.   
DBGET integrated database retrieval system