KEGG   Pseudomonas fluorescens Pf0-1: Pfl01_3461Help
Entry
Pfl01_3461        CDS       T00283                                 

Gene name
melC2
Definition
(GenBank) tyrosinase (monophenol monooxygenase)
  KO
K00505  tyrosinase [EC:1.14.18.1]
Organism
pfo  Pseudomonas fluorescens Pf0-1
Pathway
pfo00350  Tyrosine metabolism
pfo01100  Metabolic pathways
pfo01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pfo00001]
 Metabolism
  Amino acid metabolism
   00350 Tyrosine metabolism
    Pfl01_3461 (melC2)
Enzymes [BR:pfo01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.18  With another compound as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.18.1  tyrosinase
     Pfl01_3461 (melC2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Tyrosinase
Motif
Other DBs
NCBI-ProteinID: ABA75199
UniProt: Q3KAK5
Position
3945795..3946640
Genome map
AA seq 281 aa AA seqDB search
MDIRRNHRDLSREEKSAFINAVLRLKNNVNSVLRPGQQSRYDDFVQIHKNSMGRGNPLAP
SPHQSPLFYPWHRVLIRQFELELQAAADDPRITLPYWNWQIGGADNPFTSDFMGGNGDNT
QNQLVTSGPFSNNQSPFIVSVWDEGVGDAGLRRNLGAAGALPSPETVISALNRTSYWMEP
GGWENFSERELHNPVHAWIGGNMMEASSPNDPIFFLHHCYLDLLWERWKHQHPNVPSFPQ
EELSNSTLVFHPENELAPWPQSFTIEQTLFTEELGYRYEYL
NT seq 846 nt NT seq  +upstreamnt  +downstreamnt
atggatattcgccgtaaccaccgggatctgtcccgggaagagaaatccgccttcatcaac
gcagtcctcaggctgaaaaacaacgtcaacagcgtgctgcgtcccggtcagcaaagccgt
tacgatgacttcgttcagatccacaaaaactcaatgggacgtggcaatccgctcgcaccc
agccctcatcaaagccccttgttttatccgtggcaccgggtcctgatccgccagttcgaa
ctggagctgcaggccgccgccgatgaccctcgcatcacactgccctactggaactggcaa
atcggcggcgccgacaatccattcacctcggacttcatgggcggcaacggtgacaatacc
cagaatcagctggtaaccagcggacccttttccaataaccagtcgccattcattgtctcg
gtatgggacgagggtgtcggtgacgcgggcttgcgtcgcaatctcggggctgcgggcgcc
ttgccgtcaccagaaaccgtcatctcggccctgaacagaacgtcctattggatggagccg
ggcggttgggaaaacttttccgaacgtgaactgcacaatcccgtgcatgcctggatcgga
ggcaacatgatggaggcatcctctcccaatgacccgatattcttcctgcatcattgttat
ctggatctgctctgggagcgctggaaacaccagcatccgaacgttccctctttcccgcag
gaggaactgagcaactcgacactggtctttcaccccgaaaacgaactcgctccgtggcct
caaagcttcaccattgagcagactctttttaccgaagaactgggttatcgatatgaatac
ctgtga

DBGET integrated database retrieval system