KEGG   Pseudomonas fluorescens Pf0-1: Pfl01_3461Help
Entry
Pfl01_3461        CDS       T00283                                 

Definition
tyrosinase
Orthology
K00505  
tyrosinase [EC:1.14.18.1]
Organism
pfo  Pseudomonas fluorescens Pf0-1
Pathway
Tyrosine metabolism
Riboflavin metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pfo00001]
 Metabolism
  Amino acid metabolism
   00350 Tyrosine metabolism
    Pfl01_3461
  Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    Pfl01_3461
Enzymes [BR:pfo01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.18  With another compound as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.18.1  tyrosinase
     Pfl01_3461
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3945795..3946640
Genome map
AA seq 281 aa AA seqDB search
MDIRRNHRDLSREEKSAFINAVLRLKNNVNSVLRPGQQSRYDDFVQIHKNSMGRGNPLAP
SPHQSPLFYPWHRVLIRQFELELQAAADDPRITLPYWNWQIGGADNPFTSDFMGGNGDNT
QNQLVTSGPFSNNQSPFIVSVWDEGVGDAGLRRNLGAAGALPSPETVISALNRTSYWMEP
GGWENFSERELHNPVHAWIGGNMMEASSPNDPIFFLHHCYLDLLWERWKHQHPNVPSFPQ
EELSNSTLVFHPENELAPWPQSFTIEQTLFTEELGYRYEYL
NT seq 846 nt NT seq  +upstreamnt  +downstreamnt
atggatattcgccgtaaccaccgggatctgtcccgggaagagaaatccgccttcatcaac
gcagtcctcaggctgaaaaacaacgtcaacagcgtgctgcgtcccggtcagcaaagccgt
tacgatgacttcgttcagatccacaaaaactcaatgggacgtggcaatccgctcgcaccc
agccctcatcaaagccccttgttttatccgtggcaccgggtcctgatccgccagttcgaa
ctggagctgcaggccgccgccgatgaccctcgcatcacactgccctactggaactggcaa
atcggcggcgccgacaatccattcacctcggacttcatgggcggcaacggtgacaatacc
cagaatcagctggtaaccagcggacccttttccaataaccagtcgccattcattgtctcg
gtatgggacgagggtgtcggtgacgcgggcttgcgtcgcaatctcggggctgcgggcgcc
ttgccgtcaccagaaaccgtcatctcggccctgaacagaacgtcctattggatggagccg
ggcggttgggaaaacttttccgaacgtgaactgcacaatcccgtgcatgcctggatcgga
ggcaacatgatggaggcatcctctcccaatgacccgatattcttcctgcatcattgttat
ctggatctgctctgggagcgctggaaacaccagcatccgaacgttccctctttcccgcag
gaggaactgagcaactcgacactggtctttcaccccgaaaacgaactcgctccgtggcct
caaagcttcaccattgagcagactctttttaccgaagaactgggttatcgatatgaatac
ctgtga

  All links  
No link information was found.   
DBGET integrated database retrieval system