KEGG   Pseudomonas fluorescens Pf0-1: Pfl01_3552Help
Entry
Pfl01_3552        CDS       T00283                                 

Definition
cytochrome c, class I
Orthology
K08738  
cytochrome c
Organism
pfo  Pseudomonas fluorescens Pf0-1
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:pfo00920]
Environmental Information Processing; Signal transduction; Two-component system [PATH:pfo02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(4024601..4024987)
Genome map
AA seq 128 aa AA seqDB search
MKNAALTFALILNAGLFSTPTLAAGDAEAGAKIFPRLCGGCHQVGESARPGFGPELNGII
GRPAGTSANYVYSDAMKNSGLTWDRETLTAYLKDPKGVVPGTRMIFWGLSDEEKIDNLLA
YLQTFSQQ
NT seq 387 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaacgctgcactgactttcgccctgatcctcaacgcaggcctgttcagcacgcca
acactggctgccggtgacgccgaggccggcgccaaaatcttcccgcgcctgtgcggcggc
tgccaccaggtcggcgaatccgcccggccggggttcggccccgaactcaacggcatcatc
ggtcgcccggcggggacgtcggcgaattacgtgtattccgatgcgatgaaaaactccggc
ctgacttgggatcgcgaaacgctgacggcgtatctgaaggatccgaagggggtggtgccg
gggactcggatgattttctggggcctgagtgacgaggagaagattgataatttgttggcg
tatctgcagacgttttctcaacaatga

DBGET integrated database retrieval system