KEGG   Pseudomonas fluorescens Pf0-1: Pfl01_3602Help
Entry
Pfl01_3602        CDS       T00283                                 

Definition
isocitrate lyase (EC:4.1.3.1)
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
pfo  Pseudomonas fluorescens Pf0-1
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pfo00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Pfl01_3602
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Pfl01_3602
Enzymes [BR:pfo01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     Pfl01_3602
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4071095..4072420
Genome map
AA seq 441 aa AA seqDB search
MALTREQQIAALEKDWAENPRWKGVTRNYSAADVVRLRGSVQPEHTFAKMGAEKLWNLVT
QGAKPSFRPEKDFVNCMGALTGGQAVQQVKAGIQAIYLSGWQVAADNNSAESMYPDQSLY
PVDSVPTVVKRINNSFRRADQIQWKAGKNPGDEGYIDYFAPIVADAEAGFGGVLNAYELM
KSMIEAGAAGVHFEDQLASVKKCGHMGGKVLVPTQEAVQKLTAARLAADVAGVPTIILAR
TDANAADLLTSDCDPYDQPFVTGTRTQEGFYKVRAGLDQAIARGLAYAPYADLIWCETAK
PDLDEARRFAEAIKKEYPDQILSYNCSPSFNWKKNLDDATIAKFQRELSAMGYKHQFITL
AGIHNMWHSMFNLAHDYARNDMTAYVKLQEQEFADAAKGYTFVAHQQEVGTGYFDDMTTV
IQGGTSSVTALTGSTEEEQFH
NT seq 1326 nt NT seq  +upstreamnt  +downstreamnt
atggcactgacacgcgaacagcaaattgcagcccttgaaaaagactgggctgaaaacccg
cgctggaaaggcgtgactcgcaattactccgctgctgacgtcgtccgtctgcgtggctcg
gttcaaccagagcacacctttgcaaaaatgggcgccgaaaaactgtggaacctggtcacc
cagggtgccaagccgtccttccgcccagagaaagacttcgtcaactgcatgggcgccctg
accggcggccaggctgtgcagcaggtcaaagccggtatccaggcgatctacctgtcgggc
tggcaagtcgctgcggacaacaactccgctgaatcgatgtacccggaccagtcgctgtac
ccggtggactcggttccgaccgtggtcaagcgcatcaacaactcgttccgtcgtgccgac
cagatccagtggaaagccggcaagaacccgggcgacgaaggttacatcgactacttcgcg
ccaatcgtggctgacgctgaagccgggttcggcggcgtactgaacgcctacgagctgatg
aagagcatgatcgaagcaggcgccgccggcgttcacttcgaagaccaactggcttccgtg
aagaaatgcggccacatgggcggcaaggtgctggttccaacccaggaagccgtgcagaag
ctgaccgctgcccgtctggctgccgacgttgccggcgtaccgaccatcatcctggcccgt
accgacgccaacgctgccgacctgctgacttccgactgcgacccgtacgaccagccgttc
gtgactggcacccgtacccaggaaggtttctacaaggttcgtgcaggtctggaccaggca
atcgcccgtggcctggcctacgcgccgtacgccgacctgatctggtgcgaaaccgccaaa
ccggacctggacgaagcccgtcgtttcgctgaagcgatcaagaaggaatatccggaccag
atcctctcttacaactgctcgccttccttcaactggaagaaaaacctggacgacgcgacc
atcgccaagttccagcgcgaactgtccgccatgggttacaagcaccagttcattaccctg
gccggcattcacaacatgtggcacagcatgttcaacctggcgcacgactacgcccgcaac
gacatgactgcctacgtgaagctgcaagagcaggaattcgctgacgccgccaagggttac
accttcgtggctcaccagcaggaagtgggcactggctacttcgacgacatgaccaccgtg
atccagggcggcacgtcctcggtgaccgcgctgaccggttcgaccgaagaagaacagttc
cactga

DBGET integrated database retrieval system