KEGG   Pseudomonas fluorescens Pf0-1: Pfl01_3731Help
Entry
Pfl01_3731        CDS       T00283                                 

Definition
aldose 1-epimerase
Orthology
K01785  
aldose 1-epimerase [EC:5.1.3.3]
Organism
pfo  Pseudomonas fluorescens Pf0-1
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:pfo00010]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:pfo00052]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4216247..4217395
Genome map
AA seq 382 aa AA seqDB search
MLQSRHSLCGLGLSLMIATLSAQAAGLTSEHKAFGKTNDGTPVEQYILRNSHGMQATVIT
YGATLQALQVPDKHGKLDDIVLGFDDVQGYQKGTAYFGATIGRFGNRLADGAFELDGKRY
QVPQNDKTNALHGGTQGFDKKVWKAKETKDKDSVGVTLTYLSADGEMGFPGNLTTEVTYR
LTDSNELRIDYKASTDKPTVLNLTNHSYFNLAGAGNGDILKQVATLHASHYTPVTAKLIP
TGELAPVAGTPMDFTKPTAIGQHIKADHPQLKFAEEKQGGFDFNWALDTKGDVSKLAAEV
SDPQSGRHLQLYTNEPGVQFYTSNFLDGTVKGKGGKVYPHWGAFTLETQHYPDSPNQPNF
PSTRLDPGQTYTQSVVLKFSAK
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgcttcaatcccgacactcactctgcggcctcggactgtccctgatgatcgccaccctc
tccgcccaggccgccggcctgaccagcgaacacaaagccttcggcaaaaccaatgacggc
acgccggtcgagcaatacatcctgcgcaacagccacggcatgcaagccacggtcatcacc
tacggcgcgaccttgcaggcgctgcaagtgccggacaagcacggcaagctcgacgacatc
gtcctcggtttcgatgatgtgcagggttatcagaaaggcaccgcgtacttcggcgcaacc
atcggccgcttcggcaatcgcctggccgacggcgcattcgaactcgacggcaagcgctat
caagtgccgcagaacgacaagaccaacgccttgcacggcggcactcagggcttcgacaaa
aaggtctggaaggcgaaggaaaccaaagacaaggattcggtcggcgtgaccctgacctat
ctgtcggcggatggtgaaatgggtttccccggcaacctcaccaccgaggtgacctaccgc
cttaccgactctaacgagctgcgcatcgactacaaggccagcaccgacaaacccactgtg
ctcaacctgaccaaccacagctacttcaaccttgccggcgccggcaatggcgacatcctc
aagcaagtcgccaccctgcacgccagccattacaccccagtcaccgccaagctgatcccg
accggcgaactggcgcccgtggccggcacaccgatggacttcaccaaaccgaccgccatc
ggccagcacatcaaggccgaccatccgcagttgaaattcgctgaggagaaacaaggcggc
ttcgatttcaactgggcgctggacaccaagggtgacgtcagcaaactcgccgccgaagtc
agcgacccgcaatccggtcgccacttgcagctgtacaccaacgaaccgggcgtgcagttc
tacaccagcaacttcctcgacggcacggtcaagggcaagggtggcaaggtctatccgcac
tggggagcgttcactctggaaacccagcattatccggactcgccgaaccagccgaacttc
ccgagtacccgcctcgatcccggccagacctacacccagagcgtggtgttgaagttctcc
gccaagtaa

DBGET integrated database retrieval system