KEGG   Pseudomonas fluorescens Pf0-1: Pfl01_3751Help
Entry
Pfl01_3751        CDS       T00283                                 

Gene name
hemB
Definition
(GenBank) delta-aminolevulinic acid dehydratase
  KO
K01698  porphobilinogen synthase [EC:4.2.1.24]
Organism
pfo  Pseudomonas fluorescens Pf0-1
Pathway
pfo00860  Porphyrin and chlorophyll metabolism
pfo01100  Metabolic pathways
pfo01110  Biosynthesis of secondary metabolites
pfo01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:pfo00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Pfl01_3751 (hemB)
Enzymes [BR:pfo01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     Pfl01_3751 (hemB)
Exosome [BR:pfo04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Pfl01_3751 (hemB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ALAD
Motif
Other DBs
NCBI-ProteinID: ABA75489
UniProt: Q3K9R5
Position
complement(4239432..4240406)
Genome map
AA seq 324 aa AA seqDB search
MSSQFPEARPRRLRRNASLRSLFQETEFSLNDLVLPIFVEEEIDDFVPIKSMPGVMRIPE
RKLAGEIERYARAGIKSVMTFGVSHHLDANGSDTWRENGLVSRMSRIAKDAVPDMIVMSD
TCFCEYTDHGHCGVMHNHEVDNDQTLINLGKQAVAAARAGADVIAPSAAMDGQVRAIRRA
LDDAGFSQIPIMAYSTKFASALYGPFREAGGSALKGDRKSYQMNPMNRREALRESLLDEQ
EGADALMVKPAGAYLDIIRDIREASTLPLAAYQVSGEYAMIKFGAQAGAIDEDRVVRESL
GAIKRAGADLIFTYFAMDLALAGI
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgtccagtcagttccccgaagcacgtccacgccgtctgcgccgcaatgcgagcctgcgc
agcctgttccaggaaaccgagttttccctcaacgatctggtgctgccgatcttcgtcgaa
gaagagatcgacgacttcgtgccgatcaagagcatgcccggcgtgatgcgcattcccgag
cgcaaactggccggcgagatcgagcgttacgcccgggccgggatcaagtcggtgatgacg
tttggcgtgtctcatcacctggacgccaacggcagcgacacctggcgtgagaacggtctg
gtgtctcgcatgtcgcggatcgccaaggacgccgtgccggacatgatcgtgatgtcagac
acctgcttctgcgagtacaccgaccacggccattgcggcgtgatgcacaaccatgaagtc
gacaacgaccagaccctgatcaacctcggcaagcaagcggtggcggcggcgcgtgccggt
gccgacgtgatcgcgccatcggcagcgatggacggccaggtgcgggcgattcgccgggcg
ctggacgatgccggcttctcgcagattccgatcatggcctactcgaccaaattcgcctcg
gcgctctacggcccgttccgcgaggctggtggcagcgcgctgaagggcgatcgcaaaagc
tatcagatgaacccgatgaaccgccgcgaagccctgcgcgaatcgttgctcgacgagcag
gaaggcgccgacgcactgatggtcaaaccggccggcgcgtacctggacatcatccgcgac
atccgcgaagcctcgaccctgccgctggcggcgtatcaggtcagcggcgagtacgcgatg
atcaagttcggcgcccaggccggggctatcgacgaagatcgcgtggtgcgcgaaagcctc
ggtgcgatcaaacgcgcgggtgcggatctgatcttcacctactttgcgatggacctggcc
ctggccgggatctga

DBGET integrated database retrieval system