KEGG   Pseudomonas fluorescens Pf0-1: Pfl01_3751Help
Entry
Pfl01_3751        CDS       T00283                                 

Definition
delta-aminolevulinic acid dehydratase (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
pfo  Pseudomonas fluorescens Pf0-1
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pfo00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Pfl01_3751
Enzymes [BR:pfo01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     Pfl01_3751
Exosome [BR:pfo04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Pfl01_3751
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(4239432..4240406)
Genome map
AA seq 324 aa AA seqDB search
MSSQFPEARPRRLRRNASLRSLFQETEFSLNDLVLPIFVEEEIDDFVPIKSMPGVMRIPE
RKLAGEIERYARAGIKSVMTFGVSHHLDANGSDTWRENGLVSRMSRIAKDAVPDMIVMSD
TCFCEYTDHGHCGVMHNHEVDNDQTLINLGKQAVAAARAGADVIAPSAAMDGQVRAIRRA
LDDAGFSQIPIMAYSTKFASALYGPFREAGGSALKGDRKSYQMNPMNRREALRESLLDEQ
EGADALMVKPAGAYLDIIRDIREASTLPLAAYQVSGEYAMIKFGAQAGAIDEDRVVRESL
GAIKRAGADLIFTYFAMDLALAGI
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgtccagtcagttccccgaagcacgtccacgccgtctgcgccgcaatgcgagcctgcgc
agcctgttccaggaaaccgagttttccctcaacgatctggtgctgccgatcttcgtcgaa
gaagagatcgacgacttcgtgccgatcaagagcatgcccggcgtgatgcgcattcccgag
cgcaaactggccggcgagatcgagcgttacgcccgggccgggatcaagtcggtgatgacg
tttggcgtgtctcatcacctggacgccaacggcagcgacacctggcgtgagaacggtctg
gtgtctcgcatgtcgcggatcgccaaggacgccgtgccggacatgatcgtgatgtcagac
acctgcttctgcgagtacaccgaccacggccattgcggcgtgatgcacaaccatgaagtc
gacaacgaccagaccctgatcaacctcggcaagcaagcggtggcggcggcgcgtgccggt
gccgacgtgatcgcgccatcggcagcgatggacggccaggtgcgggcgattcgccgggcg
ctggacgatgccggcttctcgcagattccgatcatggcctactcgaccaaattcgcctcg
gcgctctacggcccgttccgcgaggctggtggcagcgcgctgaagggcgatcgcaaaagc
tatcagatgaacccgatgaaccgccgcgaagccctgcgcgaatcgttgctcgacgagcag
gaaggcgccgacgcactgatggtcaaaccggccggcgcgtacctggacatcatccgcgac
atccgcgaagcctcgaccctgccgctggcggcgtatcaggtcagcggcgagtacgcgatg
atcaagttcggcgcccaggccggggctatcgacgaagatcgcgtggtgcgcgaaagcctc
ggtgcgatcaaacgcgcgggtgcggatctgatcttcacctactttgcgatggacctggcc
ctggccgggatctga

DBGET integrated database retrieval system