KEGG   Pseudomonas fluorescens Pf0-1: Pfl01_3870Help
Entry
Pfl01_3870        CDS       T00283                                 

Definition
beta-hexosaminidase (EC:3.2.1.52)
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
pfo  Pseudomonas fluorescens Pf0-1
Pathway
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
beta-Lactam resistance
Module
beta-Lactam resistance, AmpC system
Brite
KEGG Orthology (KO) [BR:pfo00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Pfl01_3870
 Human Diseases
  Drug resistance
   01501 beta-Lactam resistance
    Pfl01_3870
Enzymes [BR:pfo01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     Pfl01_3870
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(4376382..4377392)
Genome map
AA seq 336 aa AA seqDB search
MTAGLQGSLMVDVAGTWLTAEDRQLLRQPEVGGLIIFARNIEHPRQVRELSAAIRAIRPD
LLLAVDQEGGRVQRLRQGFVRLPAMRAIADNPNAEYLAEQCGWIMATEVLAVGLDLSFAP
VLDLDYQRSAVVGTRSFEGDPERAALLAGAFIKGMNNAGMAATGKHFPGHGWAEADSHVA
IPNDERSLEEIRANDLVPFARLSKQLAAVMPAHVIYPQVDAQPAGFSRRWLQDILRGELQ
FDGVIFSDDLSMAGAHVVGDAASRIEAALSAGCDMGLVCNDRAAAELALSATQRMKVKPS
PRIARMRGQAFANTEYRQDPRWLTAVGALKDAQLID
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgactgctggcctgcaaggctcgttgatggtggacgtcgccggtacctggctgacggcc
gaagatcgccaattgttgcgccagcccgaagtgggcggcctgatcatctttgcccgcaac
atcgagcatccgcgccaggtgcgcgagctgagcgcggcgatccgtgccattcgtccggac
ttgctgctggcggtggatcaggagggcggccgcgtccagcgcctgcgtcagggcttcgtc
cgtttgccagccatgcgcgccatcgctgacaacccgaacgccgagtatctcgccgaacaa
tgcggctggatcatggccaccgaagtgctggcggtcggcctcgacctgagcttcgcgccg
gtgctggatctggattaccagcgcagtgccgtcgtcggcacccgctcgttcgaaggtgac
ccggagcgcgccgcgctactcgccggtgcgttcatcaaaggcatgaacaacgccggcatg
gccgccaccggcaagcatttccctggccacggctgggcggaagccgactcccacgtcgca
atccccaacgacgagcgcagccttgaagagatccgcgccaacgacctcgtgccgttcgcc
agactcagcaagcaactggccgccgtcatgcccgcccacgtcatttacccgcaagtcgat
gcacagcccgccggtttctcccggcgctggttgcaggacatcctgcgcggcgagctgcag
tttgacggcgtgatcttcagcgatgacctgtcgatggccggcgcgcatgtagtgggcgac
gccgccagtcgtatcgaagcggctctcagcgccggttgcgacatgggcctggtgtgcaac
gaccgcgccgccgctgaactggccctgagcgctacgcagcgcatgaaggtcaagccgtcg
ccgcgtatcgcacgcatgcgcggtcaggcattcgccaacaccgaataccgtcaggatccg
cgctggctgaccgctgtcggtgcgctcaaagacgctcaactgatcgattaa

DBGET integrated database retrieval system