KEGG   Pseudomonas fluorescens Pf0-1: Pfl01_3981Help
Entry
Pfl01_3981        CDS       T00283                                 

Definition
glutathione peroxidase
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
pfo  Pseudomonas fluorescens Pf0-1
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Class
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:pfo00590]
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:pfo00480]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(4510522..4511007)
Genome map
AA seq 161 aa AA seqDB search
MSDNLLNIPCTTIKGEQKTLADFAGKAVLVVNTASKCGFTPQYKGLEELWQTYKDQGLVV
LGFPCNQFGKQEPGNEGAISEFCELNYGVSFPLFKKIEVNGTGAHPLFVQLKKRAPGVLG
SQGIKWNFTKFLIGKDGQLVKRFAPATKPQDLSREIEALLK
NT seq 486 nt NT seq  +upstreamnt  +downstreamnt
atgagcgataacctgctgaatattccgtgcaccaccatcaagggcgagcagaagaccctc
gccgatttcgccggcaaggcggtgctggtggttaataccgccagcaaatgcggtttcact
ccgcagtacaaaggccttgaggaactgtggcagacctacaaggatcagggcctggtggtg
ctgggttttccgtgcaatcagttcggcaagcaggagccgggcaacgaaggcgccatcagc
gagttctgcgagctgaactacggtgtcagcttcccgctgttcaagaagatcgaagtcaac
ggtaccggcgcgcacccgctgttcgtgcagttgaagaagcgcgcgccgggcgtgctgggc
tcccagggcatcaagtggaacttcaccaaattcctgatcggcaaggacggccagttggtc
aagcgcttcgccccggccaccaagccgcaggatctgagccgtgagatcgaagccctgctc
aaatga

DBGET integrated database retrieval system