KEGG   Pseudomonas fluorescens Pf0-1: Pfl01_4014Help
Entry
Pfl01_4014        CDS       T00283                                 

Definition
lipolytic protein
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
pfo  Pseudomonas fluorescens Pf0-1
Pathway
Biosynthesis of unsaturated fatty acids
Class
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:pfo01040]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(4538801..4539406)
Genome map
AA seq 201 aa AA seqDB search
MRVWFLSAGLALMCMAQNAAAGTVLIVGDSISAGFGLDTRLGWVSLLEQRLKSEGFDDKV
VNASISGDTSAGGQARLPALLAEHKPELVILELGGNDGLRGMPPTQLQQNLASMIDSSRQ
SGAKVLLLGMQLPPNYGKRYTDAFAEVYGKLAEEKKIPLVPFFLDGVGGHPDLMQADGLH
PAAGAQGKLLENVWPTLKPLL
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgtgtggtttttgagtgctggcctggccttgatgtgcatggcccagaacgcagcg
gcgggtacagtcctgatcgttggcgatagtatcagcgccggtttcggactggatacccgg
ctggggtgggtgtcgttgctcgaacagcggctcaagagcgaaggttttgacgacaaagtg
gtcaatgcgtccatcagcggtgacaccagtgccggaggccaggcgcggctgccggcgctg
cttgcagagcacaagccggaactggtgatcctcgaattgggcggcaacgatggcctgcgc
ggaatgccgccgacgcaattgcaacaaaatcttgcttcgatgatcgacagctcccgtcaa
agcggtgccaaggtgctgttgctcggcatgcagttgccgcccaattacggcaagcgctac
actgatgccttcgccgaggtctacggcaaactcgccgaggagaaaaaaatcccgctggtg
ccgttttttctcgacggtgtgggcgggcatccggacttgatgcaggccgacggtctgcac
ccggcggccggggctcagggcaagttgctggaaaatgtctggccgacgctaaaaccgctg
ttatga

DBGET integrated database retrieval system