KEGG   Pseudomonas fluorescens Pf0-1: Pfl01_4014Help
Entry
Pfl01_4014        CDS       T00283                                 

Definition
lipolytic protein
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
pfo  Pseudomonas fluorescens Pf0-1
Pathway
Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:pfo00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    Pfl01_4014
Enzymes [BR:pfo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     Pfl01_4014
   3.1.2  Thioester hydrolases
    3.1.2.-  
     Pfl01_4014
Lipid biosynthesis proteins [BR:pfo01004]
 Fatty acid synthase
  Component type
   Pfl01_4014
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(4538801..4539406)
Genome map
AA seq 201 aa AA seqDB search
MRVWFLSAGLALMCMAQNAAAGTVLIVGDSISAGFGLDTRLGWVSLLEQRLKSEGFDDKV
VNASISGDTSAGGQARLPALLAEHKPELVILELGGNDGLRGMPPTQLQQNLASMIDSSRQ
SGAKVLLLGMQLPPNYGKRYTDAFAEVYGKLAEEKKIPLVPFFLDGVGGHPDLMQADGLH
PAAGAQGKLLENVWPTLKPLL
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgtgtggtttttgagtgctggcctggccttgatgtgcatggcccagaacgcagcg
gcgggtacagtcctgatcgttggcgatagtatcagcgccggtttcggactggatacccgg
ctggggtgggtgtcgttgctcgaacagcggctcaagagcgaaggttttgacgacaaagtg
gtcaatgcgtccatcagcggtgacaccagtgccggaggccaggcgcggctgccggcgctg
cttgcagagcacaagccggaactggtgatcctcgaattgggcggcaacgatggcctgcgc
ggaatgccgccgacgcaattgcaacaaaatcttgcttcgatgatcgacagctcccgtcaa
agcggtgccaaggtgctgttgctcggcatgcagttgccgcccaattacggcaagcgctac
actgatgccttcgccgaggtctacggcaaactcgccgaggagaaaaaaatcccgctggtg
ccgttttttctcgacggtgtgggcgggcatccggacttgatgcaggccgacggtctgcac
ccggcggccggggctcagggcaagttgctggaaaatgtctggccgacgctaaaaccgctg
ttatga

DBGET integrated database retrieval system