KEGG   Pseudomonas fluorescens Pf0-1: Pfl01_4100Help
Entry
Pfl01_4100        CDS       T00283                                 

Definition
asparagine synthase (EC:6.3.5.4)
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
pfo  Pseudomonas fluorescens Pf0-1
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pfo00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Pfl01_4100
Enzymes [BR:pfo01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     Pfl01_4100
Peptidases [BR:pfo01002]
 Cysteine Peptidases
  Family C44
   Pfl01_4100
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4642018..4643790
Genome map
AA seq 590 aa AA seqDB search
MCGLAGELRFDQQPADLAAIERITHHLAPRGPDAWGFHAQGPIALGHRRLKIMDLSDGSA
QPMIDSQLGLSLAFNGAIYNFPELRAELEALGYAFYSGGDTEVLLKGYHAWGEALLPKLN
GMFAFAIWERDAQRLFIARDRLGVKPLYLSRTGQRLRFASALPALLKGGDINPILDPVAL
NHYLNFHAVVPAPRTLLAGIEKLPPASWMRIEADGTTEQKTWWTLPYGPHADEKNLTLED
WRDRVLDSTREAVAIRQRAAVDVGVLLSGGVDSSMLVGLLREVGVENLSTFSIGFQDAGG
ERGDEFQYSDLIAKHYGTQHHQLRIDEKEIIEQLPAAFRAMSEPMVSHDCIAFYLLSREV
AKHCKVVQSGQGADELFAGYHWYPQVDGAADPYAAYREAFFDRSYDDYAATVQPKWLTAN
DAAGDFVKEHFAQPGADAAVDKALRLDSTVMLVDDPVKRVDNMTMAWGLEARTPFLDYRL
VELSARIPGQFKLPDGGKQVLKEAARRVIPSEVIDRKKGYFPVPGLKHLQGETLSWVREL
LLDPSQDRGLFNPAMLDQLLTDPQGQLTPLRGSKLWQLAALNLWLSEQGI
NT seq 1773 nt NT seq  +upstreamnt  +downstreamnt
atgtgcggattagctggcgagttacgttttgatcaacaacctgcagaccttgcagccatc
gagcgaatcacccatcacctggcgcctcgcggccccgacgcgtggggtttccatgcccaa
gggccgattgccctgggccatcgacgcctgaaaatcatggacttgtcggacggctcggcg
cagccgatgatcgacagtcaactgggcctgtccctggccttcaacggcgcgatctacaac
ttcccggaactgcgcgccgaactcgaagcgctcggttatgcgttttactccggcggcgac
accgaagtgctgctcaagggttatcacgcctggggcgaagcgctgctgccgaaactcaac
ggcatgtttgccttcgccatctgggagcgtgatgcccagcgtctgttcattgcccgcgac
cgtctcggcgtgaagccgctgtacctgtcgcgcaccggccagcgcctgcgttttgcctcg
gccctgccagcgctgctcaagggcggtgacatcaacccgatcctcgatccggtggcgctc
aaccattacctgaatttccacgccgtggtgcctgcgccgcgcaccttgctggcgggcatc
gaaaagctgccacccgcgagctggatgcgcattgaagcggacggcaccaccgagcagaaa
acctggtggaccctgccctacggcccacacgccgacgagaaaaacctgaccctggaagac
tggcgtgaccgcgtactcgacagcacccgcgaagccgtagccatccgccaacgggcggcg
gtggatgtcggcgtgctgctttccggcggcgtcgattcgagcatgctcgtcggcctgtta
cgcgaagtcggcgtggaaaacctgtcgaccttttccatcggttttcaggatgccggcggc
gagcgcggcgacgaattccagtactccgatctgatcgccaagcattacggtacgcaacac
catcaactgcgcatcgacgaaaaagaaatcatcgagcaactgcccgccgcgttccgcgcg
atgagcgagccgatggtcagccacgattgcatcgccttctatctgctgtcccgcgaagtg
gccaagcactgcaaggttgtgcaaagcggccagggcgccgacgagttgttcgccggttat
cactggtatccgcaagtcgacggtgcagccgatccctatgcggcttatcgcgaggcattt
ttcgaccgcagctacgacgactatgcggccacggtgcagccgaaatggctgaccgccaat
gacgctgccggcgacttcgtgaaggaacatttcgcacagcccggcgccgatgcggcggtc
gacaaggccctgcgcctggacagcacggtgatgctggtggacgacccggtcaaacgcgtc
gacaacatgaccatggcctggggcctggaggcgcgcacgccgtttctcgactatcgcctg
gtggaattgtcggcccgcattccgggccagttcaaactgccggacggcggcaagcaggtg
ttgaaagaagccgcgcgacgggtgattccgagtgaagtgatcgaccgcaagaaaggctac
ttcccggtgccgggtctcaagcatttgcagggcgagaccctgagctgggtccgcgaactg
ctgctggatccgagtcaggatcgcggcctgttcaacccggccatgctcgaccaattgctg
accgatccacaaggccagttgaccccgctgcgcggctccaagctgtggcaactggcggct
ttgaacctgtggctcagcgaacaaggaatctga

DBGET integrated database retrieval system