KEGG   Pseudomonas fluorescens Pf0-1: Pfl01_4374Help
Entry
Pfl01_4374        CDS       T00283                                 

Gene name
glk
Definition
(GenBank) glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
pfo  Pseudomonas fluorescens Pf0-1
Pathway
pfo00010  Glycolysis / Gluconeogenesis
pfo00052  Galactose metabolism
pfo00500  Starch and sucrose metabolism
pfo00520  Amino sugar and nucleotide sugar metabolism
pfo00521  Streptomycin biosynthesis
pfo01100  Metabolic pathways
pfo01110  Biosynthesis of secondary metabolites
pfo01120  Microbial metabolism in diverse environments
pfo01130  Biosynthesis of antibiotics
pfo01200  Carbon metabolism
Module
pfo_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:pfo00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Pfl01_4374 (glk)
   00052 Galactose metabolism
    Pfl01_4374 (glk)
   00500 Starch and sucrose metabolism
    Pfl01_4374 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    Pfl01_4374 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Pfl01_4374 (glk)
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    Pfl01_4374 (glk)
Enzymes [BR:pfo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Pfl01_4374 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucokinase Pan_kinase
Motif
Other DBs
NCBI-ProteinID: ABA76111
UniProt: Q3K7Z3
Position
complement(4928279..4929235)
Genome map
AA seq 318 aa AA seqDB search
MKLALVGDIGGTNARFALWKDQQLESVQVLATADHASPEEAISLYLSKLGLAPGAIGSVC
LSVAGPVSGDEFKFTNNHWRLSRKAFCQTLQVEQLLLVNDFSAMALGMTRLQPGEFRVVC
EGTPEPLRPAVVIGPGTGLGVGTLLDLGEGRFAALPGEGGHVDLPLSSPRETQLWQHIHN
EIGHVSAETALSGGGLPRVYRAICAVDGHEPKLDTPEAITAAGLAGDPIALEVLEQFCCW
LGRVAGNNVLTTGGRGGVYIVGGVIPRFADFFLESGFARSFADKGCMSDYFKGIPVWLVT
APYSGLVGAGVALEQSGQ
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
ttgaaactggctttggtcggtgacatcggaggcaccaacgcgcggttcgcgttgtggaaa
gatcagcagctcgaatcggttcaggtgctggccacggccgaccatgccagcccggaagag
gcgatcagcctctatctgagcaagctcggtctggcgccgggcgccatcggttcggtgtgc
ctgtcggtggcggggccggtgagcggcgatgaattcaagttcaccaacaaccactggcgc
ctgagccgcaaggcgttctgccagaccttgcaggtcgagcagctgttgctggtcaacgac
ttctcggcgatggcgctgggcatgacccgtttgcagcccggcgaattccgcgtggtctgc
gaaggcacgccggagccattgcgcccggcggtggtgatcggcccgggcactggcctgggc
gtcggcaccttgcttgatctcggcgaagggcggtttgccgcgttgccgggcgagggcggt
cacgtcgatctgccgctgagcagtccgcgtgaaacccagctctggcagcacatccacaac
gagatcggccacgtcagcgcggaaaccgcgttgagcggcggcggcttgccgcgggtctac
cgggcgatctgtgcggtggatggtcatgaaccgaaactcgatacaccggaagccatcact
gcggcgggacttgcaggcgacccgattgccctggaagtgctggagcagttctgctgctgg
ctcggtcgcgtggccggcaacaacgtgctgaccacgggcggccgtggcggggtgtacatc
gtgggcggcgtgattccacgttttgccgatttcttcctcgaaagcggtttcgcccgcagc
tttgccgacaagggctgcatgagcgattacttcaaggggattccggtgtggctggtgacg
gcgccgtactcggggctcgtcggtgcaggagtggcgctcgaacaatccggtcaatga

DBGET integrated database retrieval system