KEGG   Pseudomonas fluorescens Pf0-1: Pfl01_4374Help
Entry
Pfl01_4374        CDS       T00283                                 

Gene name
glk
Definition
glucokinase (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
pfo  Pseudomonas fluorescens Pf0-1
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:pfo00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Pfl01_4374 (glk)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Pfl01_4374 (glk)
   00052 Galactose metabolism
    Pfl01_4374 (glk)
   00500 Starch and sucrose metabolism
    Pfl01_4374 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    Pfl01_4374 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Pfl01_4374 (glk)
   00524 Butirosin and neomycin biosynthesis
    Pfl01_4374 (glk)
Enzymes [BR:pfo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Pfl01_4374 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(4928279..4929235)
Genome map
AA seq 318 aa AA seqDB search
MKLALVGDIGGTNARFALWKDQQLESVQVLATADHASPEEAISLYLSKLGLAPGAIGSVC
LSVAGPVSGDEFKFTNNHWRLSRKAFCQTLQVEQLLLVNDFSAMALGMTRLQPGEFRVVC
EGTPEPLRPAVVIGPGTGLGVGTLLDLGEGRFAALPGEGGHVDLPLSSPRETQLWQHIHN
EIGHVSAETALSGGGLPRVYRAICAVDGHEPKLDTPEAITAAGLAGDPIALEVLEQFCCW
LGRVAGNNVLTTGGRGGVYIVGGVIPRFADFFLESGFARSFADKGCMSDYFKGIPVWLVT
APYSGLVGAGVALEQSGQ
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
ttgaaactggctttggtcggtgacatcggaggcaccaacgcgcggttcgcgttgtggaaa
gatcagcagctcgaatcggttcaggtgctggccacggccgaccatgccagcccggaagag
gcgatcagcctctatctgagcaagctcggtctggcgccgggcgccatcggttcggtgtgc
ctgtcggtggcggggccggtgagcggcgatgaattcaagttcaccaacaaccactggcgc
ctgagccgcaaggcgttctgccagaccttgcaggtcgagcagctgttgctggtcaacgac
ttctcggcgatggcgctgggcatgacccgtttgcagcccggcgaattccgcgtggtctgc
gaaggcacgccggagccattgcgcccggcggtggtgatcggcccgggcactggcctgggc
gtcggcaccttgcttgatctcggcgaagggcggtttgccgcgttgccgggcgagggcggt
cacgtcgatctgccgctgagcagtccgcgtgaaacccagctctggcagcacatccacaac
gagatcggccacgtcagcgcggaaaccgcgttgagcggcggcggcttgccgcgggtctac
cgggcgatctgtgcggtggatggtcatgaaccgaaactcgatacaccggaagccatcact
gcggcgggacttgcaggcgacccgattgccctggaagtgctggagcagttctgctgctgg
ctcggtcgcgtggccggcaacaacgtgctgaccacgggcggccgtggcggggtgtacatc
gtgggcggcgtgattccacgttttgccgatttcttcctcgaaagcggtttcgcccgcagc
tttgccgacaagggctgcatgagcgattacttcaaggggattccggtgtggctggtgacg
gcgccgtactcggggctcgtcggtgcaggagtggcgctcgaacaatccggtcaatga

DBGET integrated database retrieval system