KEGG   Pseudomonas fluorescens Pf0-1: Pfl01_4532Help
Entry
Pfl01_4532        CDS       T00283                                 

Gene name
glpK
Definition
glycerol kinase (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
pfo  Pseudomonas fluorescens Pf0-1
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pfo00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    Pfl01_4532 (glpK)
Enzymes [BR:pfo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     Pfl01_4532 (glpK)
Exosome [BR:pfo04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Pfl01_4532 (glpK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
5105705..5107207
Genome map
AA seq 500 aa AA seqDB search
MTDIENKNYIIALDQGTTSSRAIIFDRDANVVCTAQREFAQHYPQAGWVEHDPMEIFATQ
SAVMVEALAQAGLHHDQVAAIGITNQRETTVVWDKTTGRPVYNAIVWQCRRSTEICQQLK
RDGHEDYIRDTTGLVTDPYFSGTKLKWILDNVEGSRERARNGELLFGTVDSWLIWKFTGG
KVHVTDYTNASRTMLFNIHTLEWDAKMLEILDIPREMLPEVKASSEIYGRTKSGIAIGGI
AGDQQAALFGQMCVEPGQAKNTYGTGCFLLMNTGDKAVKSQHGMLTTIACGPRGEVAYAL
EGAVFNGGSTVQWLRDELKIVNDAHDTEYFANKVKDSNGVYLVPAFTGLGAPYWDPYARG
ALFGLTRGVRVDHIIRAALESIAYQTRDVLDAMQQDSGERLKALRVDGGAVANNFLMQFQ
ADILGTQVERPKMRETTALGAAYLAGLACGFWGSLEELRGKAVIEREFEPSLDEVEKEKL
YKGWKKAVSRTRDWAREDAE
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atgaccgacattgagaataagaactacatcattgccctcgatcagggtacgaccagctcc
cgcgcgatcattttcgaccgcgacgcgaacgtggtctgcaccgcacaacgcgaattcgcc
cagcactacccgcaagccggttgggtcgaacacgacccgatggaaatcttcgccacccag
agcgcggtgatggtcgaagcgctggcccaggccggcctgcaccatgaccaggtcgccgcc
atcggcatcaccaaccagcgcgaaaccaccgtggtctgggacaagaccaccggccgcccg
gtgtacaacgcgatcgtctggcaatgccggcgcagcaccgagatctgccagcagctcaag
cgcgacggtcatgaagactacatccgcgacactacgggactggtcaccgacccgtacttc
tccggcaccaaactgaagtggatcctcgacaacgtcgaaggcagccgtgagcgcgcgcgc
aacggcgaactgctgttcggcaccgtcgacagctggctgatctggaaattcactggcggt
aaagtccacgtcaccgactacaccaacgcctcgcgcaccatgctcttcaacatccacacc
ctggagtgggacgcgaagatgctggagatcctcgacatcccgcgcgagatgctgccggaa
gtcaaagcctcttcggaaatctacggccgtaccaaaagtggcatcgccatcggcggtatc
gccggcgaccagcaggctgcgctgttcggccagatgtgcgtcgagccgggccaggcaaaa
aacacttacggcaccggttgcttcctgctgatgaacaccggcgacaaagcggtgaaatcc
cagcacggcatgctcaccaccatcgcctgcggcccgcgcggcgaagtggcctacgccctg
gaaggtgccgtgttcaacggcggttcgaccgtgcagtggctgcgcgatgaactgaagatc
gtcaacgacgcccacgacaccgaatacttcgccaataaagtgaaggacagcaacggcgtg
tatctggtgccagccttcaccggcctcggtgcgccctactgggatccgtatgcccgtggc
gccctgttcggcctgacccgtggcgtgcgcgtggatcacatcatccgcgctgctctggaa
tcgattgcctatcagacccgcgacgtcctcgacgccatgcaacaggactccggcgaacgc
ctcaaggccctgcgcgtggacggcggcgcggtggcaaacaacttcctgatgcagttccag
gccgacatcctcggcacccaggtcgagcgtccgaaaatgcgcgaaaccacggcgctcggc
gcagcttatctggccggtctggcgtgcggattctggggcagcctggaagaactgcgcggc
aaggccgtgatcgagcgcgaattcgaaccgagcctggacgaagtcgagaaagagaagctg
tataaaggctggaaaaaagctgtcagccgtacccgtgactgggcgcgtgaagacgctgaa
taa

  All links  
No link information was found.   
DBGET integrated database retrieval system