KEGG   Pseudomonas fluorescens Pf0-1: Pfl01_4553Help
Entry
Pfl01_4553        CDS       T00283                                 

Definition
di-heme cytochrome c peroxidase
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
pfo  Pseudomonas fluorescens Pf0-1
Brite
Enzymes [BR:pfo01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     Pfl01_4553
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
5135295..5136239
Genome map
AA seq 314 aa AA seqDB search
MNRPALFLLFALCANTLAAPLDEPLKPLPAIPSQDPKRVELGRQLFHDPRLSINNTLSCA
SCHQLDKGGADTRAFSNGFGGQPVAVNTPTVFNASLNFRQFWDGRVETLEEQSNVVITSP
HEMGSDWNTVVQRIADDAAYGQSFRAAYPDAVNRANIQNALATYERTLLTPGSRFDQYLL
GNTDILTLEEKYGYQRFKEYGCIACHQGVNIGGNMFQKFGVFGDYIADRGNPTVADQGRF
NVTGDEADRAVFKVPSLRNVALTAPYFHDGSAPTLERAVDVMFQYQLGRMPSEEDKTLII
LFLKTLTGQWEGKP
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atgaatcgtccggcgttgtttctactgttcgcgctatgcgcaaacaccctcgccgcgcca
ctggacgagccgctcaagcccttgccggccatcccgtcacaagaccccaagcgggtcgaa
ctgggacgtcagctgttccatgacccacggctgtcgatcaacaacacgctgtcttgcgcc
agttgccatcaactggataaaggcggcgccgacacccgcgccttctccaatggtttcggt
ggacaaccggtcgccgtcaacacaccgaccgtgttcaacgccagcctcaatttccgccag
ttctgggacggtcgcgtcgaaaccctggaagaacagagcaacgtcgtgatcaccagcccc
cacgaaatgggcagcgactggaacacggtcgtgcaacggatcgctgacgacgcagcctat
ggtcaaagctttcgtgccgcctaccccgatgccgtgaaccgggccaatatccagaatgcg
ctggccacctatgagcgcacgctgctgacccccggctcccgtttcgatcagtacctgctg
ggcaataccgatatcctgaccctcgaagaaaaatacggctatcagcgtttcaaggagtac
ggctgcattgcctgccatcagggcgtcaacattggcggcaacatgttccagaagttcggc
gtgttcggcgactacatcgccgatcgcggcaacccgacagtagccgaccagggccgcttc
aacgtgaccggtgacgaagccgatcgcgccgtgttcaaggtgccgagtctgcgcaatgtc
gccctgaccgcaccgtacttccatgacggttcggcgcccaccctcgaacgggcggttgac
gtgatgttccagtatcagttggggcgcatgcccagcgaagaagacaagaccctgatcatc
ctgtttctcaagaccctgaccggccagtgggagggcaagccatga

DBGET integrated database retrieval system