KEGG   Pseudomonas fluorescens Pf0-1: Pfl01_4752Help
Entry
Pfl01_4752        CDS       T00283                                 

Gene name
ipk
Definition
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase (EC:2.7.1.148)
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
pfo  Pseudomonas fluorescens Pf0-1
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:pfo00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
5356029..5356880
Genome map
AA seq 283 aa AA seqDB search
MTAPRLTLPSPAKLNLMLHILGRREDGYHELQTLFQFLDYGDEITFAVRDDGVIRLHTEF
DGVPHDSNLIVRAAKKLQEQSACSLGIDIWIDKILPMGGGIGGGSSNAATTLLGLNHLWR
LGWDEDRLAALGLTLGADVPVFVRGHAAFAEGVGEKLTPVEPAEPWYVVLVPQVSVSTAE
IFSDPLLTRNTPPIKVRPVPEGNSRNDCLPVVSRRYPEVRNALNLLGNFTEAKLTGTGSC
VFGGFPSKAEADKVSALLTETLTGFVAKGSNVSMLHRKLQSLL
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
atgaccgctccacgcctcactttgccttcaccggccaaactcaacctgatgttgcacatt
ctcggtcgccgtgaagacggttatcacgaattgcagacgctttttcagttcctcgactac
ggcgacgaaatcaccttcgccgtccgtgacgacggcgtgattcgcctgcacaccgaattc
gacggagtgccccacgacagcaacctgatcgtgcgcgcggcgaaaaaactgcaggaacaa
tccgcctgctcgctcggcatcgacatctggatcgacaagatcctgccgatgggcggcggc
atcgggggcggcagctcgaatgcggccaccaccctgcttggcctcaatcatttgtggcga
ctgggttgggatgaagatcgcctggctgcactgggcctgacgctgggcgccgacgtgccg
gtgttcgtgcgtggtcatgcggcttttgccgaaggtgtcggtgagaaactgaccccggtc
gagcccgccgaaccgtggtacgtcgtgctcgttccgcaagtctctgttagtacggcagaa
attttttcagatcctttgttgacacgtaacacgccgcccattaaagtgcgccccgttccc
gagggaaacagtcgaaatgactgcttgccggtggtctcgaggcgttatccagaagtacgt
aacgcattgaatttgttaggtaattttaccgaagcaaaacttaccggaactggaagttgt
gtgtttgggggcttcccaagcaaagctgaagctgataaagtctcggcccttctgacagag
acccttacagggtttgtagcgaaaggaagcaacgtttcgatgttgcatcgcaagctgcaa
agtctgctctaa

DBGET integrated database retrieval system