KEGG   Pseudomonas fluorescens Pf0-1: Pfl01_4810Help
Entry
Pfl01_4810        CDS       T00283                                 

Definition
7,8-dihydro-6-hydroxymethylpterin-pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
pfo  Pseudomonas fluorescens Pf0-1
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:pfo00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Pfl01_4810
Enzymes [BR:pfo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     Pfl01_4810
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
5427168..5427653
Genome map
AA seq 161 aa AA seqDB search
MERIYIGMGSNLADPAEQLRSAVDALKQLPDTELVGVSAFYQSDSLLPGQPRYTNAVAAL
DSALAPLDLLDALQAIENDQGRERLERWGPRTLDLDILLFGDRLIDEPRLKVPHYHMQER
AFVLYPLAELAPDDLRLADGRTLADLLAACPFVDLERLSHA
NT seq 486 nt NT seq  +upstreamnt  +downstreamnt
atggaacgcatctacattggcatgggcagcaacctggctgacccggccgaacaattgcgc
agcgcggtcgacgcactgaagcaattgcccgacaccgaactggtcggtgtatctgccttc
taccaaagcgactcgctgctgccgggccaaccgcgttacaccaacgcggttgccgcgctc
gacagcgcgctcgccccgctggatctgctcgatgccttgcaggcgatcgaaaacgatcag
ggccgcgaacgcctggagcgctggggcccgcgcacgctggatctggacattctgctgttc
ggtgatcgcctgatcgacgagccgcgcctcaaagtcccgcattaccacatgcaggaacgc
gcgttcgttctctatcccctggccgaactggctcccgatgatctgcgtctggccgatggc
cgcacccttgccgatcttctcgcagcctgcccgttcgtcgacctcgaacgcctctctcac
gcctga

DBGET integrated database retrieval system