KEGG   Pseudomonas fluorescens Pf0-1: Pfl01_5183Help
Entry
Pfl01_5183        CDS       T00283                                 

Definition
malate synthase G (EC:2.3.3.9)
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
pfo  Pseudomonas fluorescens Pf0-1
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pfo00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Pfl01_5183
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Pfl01_5183
   00630 Glyoxylate and dicarboxylate metabolism
    Pfl01_5183
Enzymes [BR:pfo01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     Pfl01_5183
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
5829193..5831370
Genome map
AA seq 725 aa AA seqDB search
MTEHVQVGGLQVAKVLFDFVNNEAIPGTGLTADKFWEGADKVIHDLAPKNKALLAKRDDF
QARIDGWHQSRAGQPHDAVAYKAFLQEIGYLLPEAADFQATTQNVDDEIARTAGPQLVVP
VMNARFALNASNARWGSLYDALYGTDAISEAGGAEKGKGYNKVRGDKVIAFARAFLDEAA
PLATGSHVDSTGYKIADGKLVVTLKGGSTSGLRNDAQLIGFQGDANAPIAILLKNNGLHF
EIQIDASTPVGQTDAAGVKDILMEAALTTIMDCEDSVAAVDADDKVVIYRNWLGLMKGDL
AESVSKGGQTFTRTMNPDRTYTKVDGSELTLHGRSLLFVRNVGHLMTIDAILDKHGNEVP
EGILDGLVTCLAAMHNLSGNTSRKNTRTGSVYIVKPKMHGPEEAAFTNELFGRIEDVLGL
KRNTLKVGIMDEERRTTVNLKACIQAASERVVFINTGFLDRTGDEIHTSMEAGPMVRKAD
MKAEKWIGAYENWNVDIGLSTGLQGRAQIGKGMWAMPDLMAAMLEQKIAHPLAGANTAWV
PSPTAAALHALHYHKVDVFARQAELAKRARASVDDILTIPLAVNPNWTPEQIKNELDNNA
QGILGYVVRWIDQGVGCSKVPDINDVGLMEDRATLRISSQHIANWLRHGVVTEAQVMESL
KRMAPVVDRQNANDPLYRPLAPNFDSNIAFQAAVELVIEGTKQPNGYTEPVLHRRRREFK
AANGL
NT seq 2178 nt NT seq  +upstreamnt  +downstreamnt
atgactgaacacgttcaagtcggtggcctgcaggtcgccaaagtcctgttcgacttcgtg
aacaacgaagccattcccggtaccggcctcaccgccgacaaattctgggaaggtgccgac
aaggtcattcacgacctggcgccgaagaacaaagccctactcgccaaacgcgatgacttc
caggctcgtatcgatggctggcaccagagccgtgccggtcagccccacgacgccgtggcc
tataaagccttcctgcaagagatcggttatctgctgccagaagcggctgatttccaggca
acgacgcaaaacgtcgatgacgaaatcgcccgtaccgccggcccgcaactcgtggtcccg
gtgatgaacgcccgcttcgccctcaacgcctcgaacgcccgctggggttcgctgtacgac
gccctgtatggcaccgacgccatcagcgaagccggcggcgcggaaaaaggcaaaggctac
aacaaggtgcgtggcgacaaagtcatcgccttcgcccgtgcgttcctcgacgaagccgcg
ccattggcgaccggctcccacgtcgattccaccggctacaagatcgctgacggcaaactg
gtcgtcaccctcaagggcggcagcaccagcggcctgcgcaacgacgcacagctgatcggc
ttccagggcgatgccaatgcgccgattgcgatcctgctgaagaacaacggcctgcatttc
gaaatccagatcgacgccagcaccccggtcggccagaccgatgccgccggcgtcaaagac
atcctgatggaagcggcgctgaccaccatcatggactgcgaagactccgtcgctgccgtc
gatgccgacgacaaagtggtgatctaccgcaactggctcggcctgatgaagggcgatctg
gcggaatccgtgtccaagggcggccagacctttacccgcaccatgaacccggaccgcacc
tacaccaaggtcgacggcagcgaactgaccctgcacggccgttcgctgttgttcgtgcgt
aacgtcggtcacctgatgaccatcgacgcgatcctcgacaagcatggcaacgaagtgccg
gaaggcatcctcgatggtctggtgacttgcctcgcggcgatgcacaacctgagcggcaac
acttcgcgcaagaacacccgcaccggttccgtgtacatcgttaaaccgaaaatgcacggc
cctgaagaagcggcgttcaccaacgagctgttcggtcgcatcgaagacgtgttgggcctc
aagcgcaacaccctgaaagtcgggatcatggacgaggaacgccgcaccacggtcaacctc
aaggcctgcatccaggcggccagcgagcgcgtggtgttcatcaacaccggtttcctcgac
cgcaccggcgacgaaatccacacctccatggaagccggcccgatggtgcgcaaggctgac
atgaaggccgagaaatggatcggcgcctacgagaactggaacgtcgatatcggtctgagc
accggcctgcagggtcgtgcgcaaatcggtaaaggcatgtgggcgatgcccgacctgatg
gcagcgatgctcgaacagaaaatcgctcacccgctggccggcgccaacactgcctgggtt
ccgtcgccgaccgccgctgcgctgcacgcgctgcactaccacaaggtcgacgtgttcgcc
cgtcaggccgagctggccaagcgtgcccgcgcttcggtcgatgacatcctgaccatcccg
ctggcggtcaacccgaactggaccccggagcagatcaagaacgaactggacaacaatgcc
cagggcattctcggttacgtggtgcgctggatcgaccagggcgtgggttgctcgaaggtg
ccggacatcaacgacgtcggcctgatggaagaccgtgcgacgctgcgtatctccagccag
cacatcgccaactggctgcgccacggtgtcgtcaccgaagcgcaagtgatggaaagcctc
aagcgcatggcgccggtggtggaccgtcagaatgccaacgacccgctgtaccgtccgctg
gccccgaacttcgacagcaacatcgccttccaggcggcggtcgaactggtgatcgagggc
accaaacagccgaacggctacaccgagccggtcctgcaccgtcgtcgtcgcgagttcaag
gctgccaacggcctttaa

DBGET integrated database retrieval system