KEGG   Pseudomonas fluorescens Pf0-1: Pfl01_5219Help
Entry
Pfl01_5219        CDS       T00283                                 

Definition
glucose-methanol-choline oxidoreductase
Orthology
K03333  
cholesterol oxidase [EC:1.1.3.6]
Organism
pfo  Pseudomonas fluorescens Pf0-1
Brite
KEGG Orthology (KO) [BR:pfo00001]
 Metabolism
  Xenobiotics biodegradation and metabolism
   00984 Steroid degradation
    Pfl01_5219
Enzymes [BR:pfo01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.3  With oxygen as acceptor
    1.1.3.6  cholesterol oxidase
     Pfl01_5219
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(5869683..5873135)
Genome map
AA seq 1150 aa AA seqDB search
MTRIATPISEIKEHYDVIVIGSGYGGGIAASRLSRAGKRVCLLERGREIQPGEYPNTMIA
ATEELQVHDPDGHIGSRTGLFDLHVNAQQNVVVGCGLGGTSLINANVSLEPTADVFKDPR
WPLAVREDHDGLLKAGYEKAREMLKPNPYPSTAPNLPKLDANKKSADFLKQGAHFYKPPI
NVTFDKLPNNLNHVGVEQLPCNHCGDCVSGCNNKAKNTTLMNYLPDATNHGAEIFCQAQV
RHLERDGNGWIVHFQYLDSGREKFDAPTLFVKADIVVVSAGTLGSTEILLRSRDKGLVMS
GQLGENMSGNGDILGFGHNCEQTINGIGFGAHSAKELQPVGPCITSIIDMRTEGDRSSRM
VIEEGSIPGALGRPMVPAMAGFAEMIGKPTDDSFSGKVKYKEREAESFLRGPYHGALHNM
QTYLIMSHDSGQGRMVLDNKDQLRIDWPGVGEQENFKIGNERLYQSTKALGGIWVENPIW
TKLLKHSIVSVHPLGGCVMGEDAAQGVVNHKGQVFSGASGTDVYANLYVTDGAVIPTSLA
VNPLLTISAVSERNMGLLAADRGWTIDYTLPSAPRKQTAPPTLGVQFTETMKGYFSRAFT
AAQSTDLKVYEAAAKRGEADNSPIDFTLTITANDLNRMIKEPEHAATIVGTVIAPALSPE
PLTASNGVFNLFEQFEQQVDTRHMKYDMKLTAEDGNDYFFSAFKTVPEDNGVLNIWHDTS
TLYVTLYRGPDKTGEVIGSGVMHIKPTDFAKQMTTMKVLNARNERERIEGLARFGKFFAG
ILWESYGGVFAGDKYFNPDAPPRLKRPLDAPTPAVHFFSTEDGVQLRLTRYQAGSKGPVM
LVHGLGVGSNIFSTDTIQTNLLEFLCKHDYDVWLLDFRVSILLPASKKEWNGDQIAQYDF
KAAIAQIQQETKAKDVQCVVHCYGATTFFMSLLAGLQGVRSVVCSQIAADTVVATATGLK
AGLHLPGMLDAIGIKSMTAYADSKENWFNRLYDKALNGYARIEAQGYCTNPVCHRITFMY
ASLYRHDTLNETLHDNLHELFGESNIETFEHLALIVRKGHLVDFKGRDVYMPHFDRLTMP
ICFISGADNQCYLPESTLKTYQRVCEKHGPERYSRHVVPGYGHIDCMFGKNAVVDVYPII
LEHLEKTALG
NT seq 3453 nt NT seq  +upstreamnt  +downstreamnt
atgacacggatcgcaacgcccatcagcgaaatcaaggaacactacgacgtgatcgtcatc
ggctccgggtatggcggcggcattgccgcgtcgcgcctgtccagggccggtaaaagggtc
tgtctgctggaacgcggtcgggaaatccagcccggcgaataccccaacaccatgatcgcc
gcgaccgaggagttgcaggtacacgatccggacggccacatcggctcgcgcaccgggttg
ttcgacctgcacgtcaacgcccagcagaacgtggtggtcggctgcggcctcggcggcacg
tcgctgatcaatgccaacgtctcgctggaaccgaccgccgacgtgttcaaggatccacgc
tggccactggcggtgcgcgaggatcacgacggcttactcaaggcgggttacgaaaaagcc
cgagagatgctcaagcccaatccctacccaagcaccgcgccgaacctgccgaagcttgat
gccaacaaaaaatcggcagacttcctcaagcaaggcgcgcatttctacaagccgccgatc
aacgtgaccttcgacaaactgcccaacaacctcaatcacgtcggcgtcgagcaactgccg
tgcaaccactgtggcgactgcgtgtcgggctgtaacaacaaggccaagaacaccacgctg
atgaactacctgccggacgccaccaatcacggcgcggagattttctgtcaggcccaggtg
cggcatctggagcgcgacggcaatggctggatcgtgcactttcagtacctggacagcggt
cgcgaaaaattcgacgcgccgacgctgtttgtgaaagccgacatcgtcgtggtctccgcc
ggcaccctcggctccactgaaattctgctgcgctcgcgggacaaaggcctggtgatgtcc
ggccagctcggcgagaacatgagcggcaacggcgacatcctcggcttcggccacaactgc
gagcagaccatcaacggcatcggtttcggcgcgcattcggccaaggaactgcaaccggtc
ggcccgtgcatcacctcgatcatcgacatgcgcaccgagggtgaccgcagcagtcgcatg
gtcatcgaggaaggctcgatccccggcgcccttggccggccgatggtgccggcgatggcc
gggttcgccgagatgatcggcaagcccaccgacgacagcttcagcggcaaggtgaagtac
aaggagcgcgaagccgaaagcttcctgcgcggcccgtaccacggcgcgctgcacaacatg
cagacctacctgatcatgagccacgacagcggccagggacgcatggtcctcgacaacaag
gatcaactgcgcatcgactggccgggcgtcggcgagcaggaaaacttcaagatcggcaac
gaacgcttgtaccagagcaccaaggccctgggcgggatctgggtcgagaatccgatctgg
accaagttgctcaagcacagcatcgtctcggtgcatccgctgggtggttgtgtgatgggt
gaagatgccgcgcaaggcgtggtcaatcacaagggccaggtgttcagcggcgccagcggc
accgatgtctacgccaacctgtacgtgaccgacggcgcggtgatcccgacatcactggcg
gtcaatccgctgctgaccatctccgccgtgagcgagcgcaacatgggcctgctggcggcc
gatcgtggctggacgatcgactacacgctgccgtcggcgccgcgcaaacagaccgcgccg
ccgacccttggcgtgcagttcaccgaaaccatgaaaggctacttctcccgcgccttcacc
gccgcgcaaagcaccgacctcaaagtctatgaagctgccgccaaacgtggcgaggcggac
aactcgccaatcgatttcaccctgaccatcaccgccaacgacctcaaccggatgatcaag
gagccggaacacgccgcgaccatcgtcggcacggtgatcgctccggcgctgtcgccggaa
ccgctgactgccagcaacggcgtgttcaacctgttcgagcaattcgagcagcaggtcgat
acgcgtcacatgaagtacgacatgaaactgaccgccgaggacggcaacgactacttcttc
agcgccttcaagaccgtgccggaagacaatggcgtgctgaacatctggcatgacaccagc
accctctacgtcacgctgtatcgcgggccggacaagaccggcgaggtgatcggctccggg
gtgatgcacatcaaaccgaccgacttcgccaagcagatgaccaccatgaaagtcctcaat
gcgcgtaacgagcgtgagcgcatcgaagggctggcgcggttcggcaagttcttcgccggg
attctctgggagagttatggcggggtgtttgccggtgacaaatacttcaaccccgacgcg
ccgccacggctgaaacggccactggatgcgccgacgccggccgtgcatttcttctccacc
gaagacggcgtgcagttgcgcctgacccgttatcaggccggcagcaaaggcccggtgatg
ctggtgcatggtctgggtgtgggttcgaatatcttctccaccgatacgatccagaccaac
ctgctggaatttttgtgcaagcacgactacgacgtgtggctgctggatttccgggtgagc
atcctgctgccggcgagcaagaaggaatggaacggcgaccagatcgcccagtacgacttc
aaggccgccatcgcacagatccagcaggaaaccaaagccaaagacgtgcagtgcgtggtg
cattgctacggcgccacgaccttcttcatgtcgctgctcgccggtttgcagggcgtgcgt
tcggtggtctgctcgcagattgccgccgacacggtggtcgcgaccgctacggggctgaag
gccgggctgcacctgccggggatgctcgatgcgatcggcatcaaatcgatgactgcctac
gccgacagcaaggagaactggttcaaccggctctacgacaaggcgctcaacggctacgcg
cggatcgaagcccagggctattgcaccaacccggtgtgccaccgcatcaccttcatgtac
gcctcgctgtatcgccacgacaccctcaatgaaaccctgcatgacaacctgcacgagctg
ttcggcgagtcgaacatcgagaccttcgagcacctggcgctgatcgtgcgcaaagggcat
ctggtggatttcaaagggcgcgacgtgtacatgccgcactttgatcggctgaccatgccg
atctgctttatcagcggtgccgacaaccagtgttatctgccggaaagcacgctcaagacc
tatcagcgggtttgtgagaagcacgggccggaacgctacagccggcatgtggtgccgggt
tacggccacatcgattgcatgttcggcaagaacgcggtggtcgatgtgtatccgatcatc
cttgaacacctggagaaaacggccctcggatag

DBGET integrated database retrieval system