KEGG   Pseudomonas fluorescens Pf0-1: Pfl01_5542Help
Entry
Pfl01_5542        CDS       T00283                                 

Definition
phosphomannomutase (EC:5.4.2.8)
Orthology
K15778  
phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
pfo  Pseudomonas fluorescens Pf0-1
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Purine metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:pfo00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Pfl01_5542
   00030 Pentose phosphate pathway
    Pfl01_5542
   00051 Fructose and mannose metabolism
    Pfl01_5542
   00052 Galactose metabolism
    Pfl01_5542
   00500 Starch and sucrose metabolism
    Pfl01_5542
   00520 Amino sugar and nucleotide sugar metabolism
    Pfl01_5542
  Nucleotide metabolism
   00230 Purine metabolism
    Pfl01_5542
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Pfl01_5542
Enzymes [BR:pfo01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     Pfl01_5542
    5.4.2.8  phosphomannomutase
     Pfl01_5542
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
6211099..6212496
Genome map
AA seq 465 aa AA seqDB search
MSTPAQVAPKLPDSIFRAYDIRGTVPEFLNAETAYWIGRAIGSQSLAQGEPNVSVGRDGR
LSGPELVAALIRGIAESGCHVSDVGLVPTPALYYAANVLAGKSGVMLTGSHNPSNYNGFK
IVIAGDTLANEQIQALHERLKTGNLSSGTGSVTQVEILDRYNTEIVQDIKLARRLKVVVD
CGNGAAGVIAPQLIEALNCEVIPLFCDVDGNFPNHHPDPGKPENLVDLIAKVKETNADIG
LAFDGDGDRVGVVTNTGTIVFPDRLLMLFARDVVARNPDAEIIFDVKCTRRLIPLIKEYG
GRPLMWKTGHSLIKKKMKQSGALLAGEMSGHIFFKERWFGFDDGIYSAARLLEILSKEKS
SAEELFATFPNDISTPEINIHVTEESKFSIIDALHDAQWGPGADLTTIDGVRVDYAKGWG
LVRASNTTPVLVLRFEADDEAELQRIKAVFHAQLKRVAPDLQLPF
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
atgagcacccccgcccaagtcgccccgaagcttcctgacagcatcttccgcgcctacgac
attcgcggcaccgtgccggaattcctcaatgccgaaaccgcctactggatcggccgcgcc
atcggctcccaaagcctggcccaaggcgaaccgaacgtgtccgtcggtcgtgacggccgc
ctgtccggtccggaactggttgccgcactgatccgcggcatcgccgagagcggctgccac
gtcagcgacgtcggcctggtgccgaccccggcgctgtactacgccgccaacgtgctggcc
ggcaaatccggcgtaatgctcactggcagccataacccgtcgaactacaacggcttcaag
atcgtgatcgccggcgataccctcgccaacgaacagatccaggccctgcacgagcgcctc
aagaccggcaacctgagcagcggcaccggcagcgtgacccaggtcgaaatcctcgaccgc
tacaacaccgaaatcgtccaggacatcaaactggcccggcgcctgaaagtcgtggtcgac
tgcggcaacggcgcggccggcgtgatcgccccgcaactgatcgaagcgctgaactgcgaa
gtcatcccgctgttctgcgatgtcgacggcaacttcccgaaccatcacccggacccgggc
aagcctgagaacctcgtcgacctgatcgccaaggtcaaggaaaccaacgccgacatcggc
ctggccttcgacggcgacggcgaccgcgtcggcgtggtgaccaacaccggcaccatcgtg
tttccggaccgcctgctgatgctgttcgcccgtgacgtggtggcgcgcaacccggacgcg
gagatcatcttcgacgtcaaatgcacccgtcgcctgatcccgctgatcaaggaatatggc
ggtcggccgctaatgtggaagaccggtcactcgttgatcaaaaagaaaatgaaacaatcc
ggcgcgctgttggccggcgaaatgagcgggcacattttcttcaaggaacgctggttcggt
ttcgacgacggcatttacagcgccgcgcggctgctggaaatcctcagcaaggaaaaatct
tcggccgaggagctgttcgcgaccttcccgaacgatatttccacgccggaaatcaatatc
catgtgaccgaagagagcaaattcagcatcattgatgcactgcacgatgcgcagtggggc
ccaggcgccgacctgaccaccattgacggcgtgcgggtcgactacgccaaaggctggggc
ctggtgcgcgcatccaacaccacaccggtgctggtgctgcgtttcgaggccgatgacgag
gctgaactgcagcgcatcaaggctgtgttccatgcccaactgaaacgcgttgcacctgat
ctccaactaccgttctga

  All links  
No link information was found.   
DBGET integrated database retrieval system