KEGG   Pseudomonas fluorescens Pf0-1: Pfl01_5549Help
Entry
Pfl01_5549        CDS       T00283                                 

Gene name
gmk
Definition
guanylate kinase (EC:2.7.4.8)
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
pfo  Pseudomonas fluorescens Pf0-1
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:pfo00230]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
6217332..6217952
Genome map
AA seq 206 aa AA seqDB search
MTHSTGTLYIISAPSGAGKSSLVKALTDTNPDIRVSISHTTRAMRPGEVDGVNYHFVTRE
EFVKMGEHGDFLERAEVFGNFYGTSQSRLQQTLDEGHDLILEIDWQGAEQVRKLMPQARS
IFILPPSLQALHQRLTNRGQDSDEIIDGRMREAVSEMSHYVEYDYLIINDDFAHALDDLK
AIFRANQLQQKRQQVRFGKLLAELLG
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
atgacccacagcaccggcaccctgtacatcatttccgccccttcgggtgcgggcaagagc
agtctggtcaaggccctgaccgacaccaatccggacattcgcgtctcgatttcccacacc
acccgcgccatgcgcccgggtgaagtggacggcgtgaactatcacttcgtgacccgcgaa
gagttcgtgaaaatgggcgagcacggcgattttctggaacgcgccgaagtcttcggcaac
ttctacggcacctcgcaaagccgcctacagcagaccctggacgaaggccacgacctgatt
ctggaaatcgactggcaaggcgccgagcaagtgcgcaagctgatgccgcaggcccgttcg
atcttcatcctgccgccatcactgcaggccctgcaccagcgcctgaccaaccgtggccag
gacagcgacgagatcatcgatggccggatgcgtgaagcggtcagcgaaatgagccactac
gtcgagtacgactacctgatcatcaacgacgatttcgcccatgcgctggacgatctgaag
gcgattttccgcgccaatcagttgcaacagaaacgtcagcaagtgcgtttcggcaaattg
ctggctgaattgctgggctga

DBGET integrated database retrieval system