KEGG   Pseudomonas fluorescens Pf0-1: Pfl01_5618Help
Entry
Pfl01_5618        CDS       T00283                                 

Definition
(GenBank) aldose 1-epimerase family protein
  KO
K01792  glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
pfo  Pseudomonas fluorescens Pf0-1
Pathway
pfo00010  Glycolysis / Gluconeogenesis
pfo01100  Metabolic pathways
pfo01110  Biosynthesis of secondary metabolites
pfo01120  Microbial metabolism in diverse environments
pfo01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:pfo00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Pfl01_5618
Enzymes [BR:pfo01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.15  glucose-6-phosphate 1-epimerase
     Pfl01_5618
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim
Motif
Other DBs
NCBI-ProteinID: ABA77355
UniProt: Q3K4E9
Position
6292886..6293785
Genome map
AA seq 299 aa AA seqDB search
MNTPNVEAVKLDELNCWRIRHGQAEVLVAQQGAHILSYQVDGQPPLIWLNDKAVFKTGKS
IRAGVPVCWPWFGKFERNPQNVQAMRTSEEPAGAHGFVRAMDWELGGIETEGESLKVEFK
LPYPEGGFPEWPHQVDLTLTLRLDDQLHISLTSHNRGTDTVSISQALHSYFAVSDVRNVR
VEGVDGLDYIETLDDWKTFTQQGDLRFAGETDRIYLDAPAQLSIVDPAWERRIVLTTTGS
RTAVIWNPWIDRAAALSDMDNDGWQRMLCIETANVMSDVMNLAPDASHTMGVSVGSQPL
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atgaacacgcccaacgttgaagccgtgaaactggatgaactgaactgctggcgcatccgc
cacggtcaggccgaagtgctggtggcccagcaaggcgcgcacatcctcagttatcaggtg
gacggccagccgcccctgatctggctgaacgacaaggccgtgttcaagaccggcaagagc
atccgcgccggtgtgccggtgtgctggccgtggttcggcaagttcgaacgcaacccgcag
aacgtgcaggcgatgcgcacgagcgaagaaccggccggtgcccacggatttgtccgggcg
atggattgggaactgggcggcatcgaaaccgaaggcgaaagcctgaaagtggaattcaag
ctgccctaccccgagggcggttttccggaatggccgcatcaggtcgacctgaccctgacc
ctgcgcctcgacgatcagttgcacatcagtctgaccagccacaaccgtggcaccgacacc
gtcagcatcagtcaggcgctgcacagctatttcgcggtcagcgatgtgcgcaacgtgcgc
gtcgaaggcgtggatggcctggattacatcgagaccctggacgactggaaaaccttcacc
cagcagggtgatctgcgttttgccggggaaaccgaccgcatctacctcgacgcccctgcg
caactgagcatcgtcgacccggcctgggaacggcgcatcgtgctgaccaccaccggctcc
cgcacggcggtgatctggaacccgtggatcgaccgcgccgctgcgctcagcgacatggac
aacgatggctggcagcgcatgctctgcatcgagacggcgaacgtgatgagtgatgtgatg
aacctggcgccggatgccagtcacaccatgggtgtcagcgtcggcagccagccactctga

DBGET integrated database retrieval system