KEGG   Pseudomonas fluorescens Pf0-1: Pfl01_5618Help
Entry
Pfl01_5618        CDS       T00283                                 

Definition
aldose 1-epimerase
Orthology
K01792  
glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
pfo  Pseudomonas fluorescens Pf0-1
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:pfo00010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
6292886..6293785
Genome map
AA seq 299 aa AA seqDB search
MNTPNVEAVKLDELNCWRIRHGQAEVLVAQQGAHILSYQVDGQPPLIWLNDKAVFKTGKS
IRAGVPVCWPWFGKFERNPQNVQAMRTSEEPAGAHGFVRAMDWELGGIETEGESLKVEFK
LPYPEGGFPEWPHQVDLTLTLRLDDQLHISLTSHNRGTDTVSISQALHSYFAVSDVRNVR
VEGVDGLDYIETLDDWKTFTQQGDLRFAGETDRIYLDAPAQLSIVDPAWERRIVLTTTGS
RTAVIWNPWIDRAAALSDMDNDGWQRMLCIETANVMSDVMNLAPDASHTMGVSVGSQPL
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atgaacacgcccaacgttgaagccgtgaaactggatgaactgaactgctggcgcatccgc
cacggtcaggccgaagtgctggtggcccagcaaggcgcgcacatcctcagttatcaggtg
gacggccagccgcccctgatctggctgaacgacaaggccgtgttcaagaccggcaagagc
atccgcgccggtgtgccggtgtgctggccgtggttcggcaagttcgaacgcaacccgcag
aacgtgcaggcgatgcgcacgagcgaagaaccggccggtgcccacggatttgtccgggcg
atggattgggaactgggcggcatcgaaaccgaaggcgaaagcctgaaagtggaattcaag
ctgccctaccccgagggcggttttccggaatggccgcatcaggtcgacctgaccctgacc
ctgcgcctcgacgatcagttgcacatcagtctgaccagccacaaccgtggcaccgacacc
gtcagcatcagtcaggcgctgcacagctatttcgcggtcagcgatgtgcgcaacgtgcgc
gtcgaaggcgtggatggcctggattacatcgagaccctggacgactggaaaaccttcacc
cagcagggtgatctgcgttttgccggggaaaccgaccgcatctacctcgacgcccctgcg
caactgagcatcgtcgacccggcctgggaacggcgcatcgtgctgaccaccaccggctcc
cgcacggcggtgatctggaacccgtggatcgaccgcgccgctgcgctcagcgacatggac
aacgatggctggcagcgcatgctctgcatcgagacggcgaacgtgatgagtgatgtgatg
aacctggcgccggatgccagtcacaccatgggtgtcagcgtcggcagccagccactctga

DBGET integrated database retrieval system