KEGG   Pseudozyma flocculosa: PFL1_00531Help
Entry
PFL1_00531        CDS       T03141                                 

Definition
hypothetical protein
Orthology
K00326  
cytochrome-b5 reductase [EC:1.6.2.2]
Organism
pfp  Pseudozyma flocculosa
Pathway
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pfp00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    PFL1_00531
Enzymes [BR:pfp01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.2  cytochrome-b5 reductase
     PFL1_00531
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Unknown
AA seq 325 aa AA seqDB search
MVLPEQFAFVASILVTFCLCLVAKSYLARSVFPHFELLQDLDRATDFMEINVVVAFLVGL
VLSVGALLYFDSGKAKPVLNPTEWQKFHLMEKKQLSSNTAKYRFRLPKQNSILGLPIGQH
ISVQADINGKTVMRSYTPTSSDDDKGFFDLVVKSYEQGNVSKYMAAMKIGDVLSVKGPKG
QMRYSPGLARHLGMIAGGTGLTPCLQIITAICKNPADKTQVDFIYANVKEDDILLKEDLD
RLAREHKDQFRIHYFLNEAPPNWTGGTGFVSKEAIEQNLPKPADDIKILMCGPPPMINAM
KKHLSELNYQAPRTVSKMEDQVFCF
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atggtcctgcccgagcaattcgccttcgtcgcatccatcctcgtcaccttctgcctctgc
ctcgtcgccaagagctacctcgcccgctccgtctttccccactttgaactcctccaagac
ctcgacagggccaccgacttcatggagatcaacgtcgtagtcgcttttctcgtcgggctc
gtcctgtcggtgggcgcgctgctctactttgactcgggcaaggccaagcccgtgctcaac
ccgactgagtggcagaagttccacctgatggaaaagaagcagctctcgtccaacacggcc
aagtaccgcttccgcctgcccaagcagaactcgatcctcggcctgcccatcgggcagcac
atttcggtccaggccgacatcaacggcaagaccgtcatgcgctcctacacgcccacctcg
tccgacgacgacaagggcttctttgacctcgtcgtcaagtcgtacgagcagggcaacgtc
tccaagtacatggccgccatgaagatcggcgacgtcctctcggtcaagggccccaagggc
cagatgcgctactcgcccggcctcgcccgccacctcggcatgattgccggcggcaccggc
ctcacgccctgcctccagatcatcacggccatctgcaagaacccggccgacaagacccag
gtcgactttatctacgccaacgtcaaggaggacgacatcctgctcaaggaggacctcgac
cgcctcgcccgcgagcacaaggaccagttccgcatccactacttcctcaacgaggcgccc
cccaactggaccggcggcaccggcttcgtctccaaggaggccatcgagcagaacctcccc
aagcccgccgacgacatcaagatcctcatgtgcggcccgccgccgatgatcaacgccatg
aagaagcacctctcggagctcaactaccaggctccccgcaccgtcagcaagatggaggac
caagtcttctgcttctga

DBGET integrated database retrieval system