KEGG   Anthracocystis flocculosa: PFL1_02546Help
Entry
PFL1_02546        CDS       T03141                                 

Definition
(RefSeq) hypothetical protein
  KO
K01193  
beta-fructofuranosidase [EC:3.2.1.26]
Organism
pfp  Anthracocystis flocculosa
Pathway
Galactose metabolism
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pfp00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    PFL1_02546
   00500 Starch and sucrose metabolism
    PFL1_02546
Enzymes [BR:pfp01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     PFL1_02546
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
Unknown
AA seq 686 aa AA seqDB search
MASVEARRPSLTTSTIPTTASFPLADPRRIAYGSHSLDFADSLRDDVAAAQGAMMVSAHN
AAVAVAKAKRAPMVAGQQQQQPQPQQQQQQRTQRRGASADDVAFHRWRPSSHLMAPDGWM
NDPCGPSYDPRTGQYHMWYQWNPKGSTWGNMSWGHATSKDLVRWQSSRSAVIQPGTQYDH
KGVFTGCVLMRGPLAEEDGTDEAVGAHQEATKAATSAAAEAAAEVRQRAQPMTAIYTAVS
HLPIHHTLPYHRGAEKLALSTSTDGGQTWTPQGCILDGPPAEVDIISWRDPYVSAWPLLD
AVLGMSSPGLYGLIAGGLKDKTPTVFAYSIDPSDLSSWQYIGHLCDVGRNSKSTPHGVDL
GKNWEVCNFFSVGPEGDAAQHHDYLLINVEGCTEPGPQRAAIYMKYEAHRRTLQGSRAGI
SLEPVRTGLLDHGCLYAASSFQDPVKDRRIMWGWITEDDLPEDQYERQGWSGCLSLPREL
FWHPDSEELGIRPVEEVLGLRTGARHVNVASLQPAAASRDSAIQIHAAGIEAPRRHLPDV
SARSLEVVASLSTPAAGRVSGFALAHSADMSTRTLVYLTADDRIVVDRSRSAGRTSVLER
GIEVKTDDIDVALARRRDGSRTTTHRVRLFLDNSVLEVFVDDAIAISTRIYPDEADVGVS
LLGCHEEGDAIDIWQGLAQAHAGFLG
NT seq 2061 nt NT seq  +upstreamnt  +downstreamnt
atggcctccgtcgaggccaggcgcccttccctgaccaccagcaccatccccaccaccgcc
agctttcccctggcagatcccagacgcatcgcctacggatcgcacagcctggacttcgcc
gactccctccgcgacgatgtggccgccgcgcagggcgccatgatggtgtcggcccacaac
gccgccgtcgccgtcgcaaaggccaagcgcgctccgatggtagctgggcagcagcagcag
cagccgcagccgcagcagcagcagcagcagcggacgcaacggcgaggcgcatcggccgac
gacgtcgcctttcaccgctggaggccctcgtcgcacctaatggcgcccgacggctggatg
aatgacccgtgcgggccatcgtacgatcctcggaccggccagtaccacatgtggtatcag
tggaacccaaagggctcgacgtggggcaacatgtcttggggccacgcgacgagcaaggac
ctcgtccgctggcagtcgagccgcagcgccgtcatacagccgggcacgcagtacgaccac
aagggcgtctttaccggctgcgtcctcatgcgagggcccttggcagaagaggatgggacg
gacgaggccgttggggcgcaccaagaggcgacgaaagcggcgacatcagcggcagcagaa
gcagcagcagaggtgcgccagcgcgcccaacccatgacggccatctacactgcagtctcg
cacctgcccatccaccacacgctgccctaccatcgcggagcagagaagctggccctctcc
acctcgaccgacggcgggcagacgtggacgccccagggctgcatcctcgacggcccgcct
gccgaggtcgacatcatctcgtggcgggatccgtacgtgtctgcctggccgctgctcgac
gctgtgcttggcatgagcagtccggggctctacggcctcattgccggaggcctcaaggac
aagacgcccacggtgttcgcctactccatcgacccctcggacctctcgtcgtggcaatac
atcggccacctctgcgacgtcgggaggaactcaaagtcaacgccgcacggcgtcgacctc
ggcaagaactgggaggtgtgcaacttcttctcggtcgggccagagggcgacgcagcgcag
caccacgactacctgctcatcaacgtcgaggggtgcaccgagccgggcccgcagcgcgcc
gccatctacatgaagtacgaggcgcaccgccgcacgctgcagggatcgcgggccggcatc
tctctcgagccggtccgcacgggcctgctggatcacggctgcctgtacgccgccagctcg
ttccaggatccggtcaaggaccgcaggatcatgtggggctggatcaccgaagacgacctg
cccgaggaccagtacgagcgccagggctggtccggctgcctctcgctgccgcgcgagctc
ttctggcatcccgattccgaggagctgggcatccgaccggtcgaagaggtgcttggcctg
cgcacgggggcgcgccacgtcaacgttgcctcgctccaaccagccgctgcatccagggac
agcgcgatccagatccacgccgctggcatcgaagcgccgcggcgacacctgccggacgtc
tctgctcgatccctcgaggtcgtcgccagcctttcgacaccggcggcaggccgcgtctct
ggattcgccctggcccacagcgccgacatgagcacgcgcacgctcgtctacctcacggcc
gacgaccgcatcgtcgtcgaccgcagccgcagcgcgggcaggacgagcgtcttggagcgg
ggcatcgaggtcaagacggacgacatcgacgtggccctcgcccgacgccgcgacggcagc
cgcacgacgacgcaccgtgtgcgcctcttcctcgacaactcggtgctcgaggtgtttgtc
gacgacgccatcgccatcagcacgcgcatctacccggacgaggccgatgtcggcgtgtcg
ctgctgggctgccacgaggaaggcgacgccatcgacatttggcaaggcctggcccaggcc
catgccggcttcctgggctga

DBGET integrated database retrieval system