KEGG   Pragia fontium: QQ39_16145Help
Entry
QQ39_16145        CDS       T03952                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
pfq  Pragia fontium
Pathway
pfq00071  Fatty acid degradation
pfq00280  Valine, leucine and isoleucine degradation
pfq00310  Lysine degradation
pfq00362  Benzoate degradation
pfq00380  Tryptophan metabolism
pfq00620  Pyruvate metabolism
pfq00630  Glyoxylate and dicarboxylate metabolism
pfq00640  Propanoate metabolism
pfq00650  Butanoate metabolism
pfq00900  Terpenoid backbone biosynthesis
pfq01100  Metabolic pathways
pfq01110  Biosynthesis of secondary metabolites
pfq01120  Microbial metabolism in diverse environments
pfq01130  Biosynthesis of antibiotics
pfq01200  Carbon metabolism
pfq01212  Fatty acid metabolism
pfq02020  Two-component system
Brite
KEGG Orthology (KO) [BR:pfq00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    QQ39_16145
   00630 Glyoxylate and dicarboxylate metabolism
    QQ39_16145
   00640 Propanoate metabolism
    QQ39_16145
   00650 Butanoate metabolism
    QQ39_16145
  Lipid metabolism
   00071 Fatty acid degradation
    QQ39_16145
   00072 Synthesis and degradation of ketone bodies
    QQ39_16145
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    QQ39_16145
   00310 Lysine degradation
    QQ39_16145
   00380 Tryptophan metabolism
    QQ39_16145
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    QQ39_16145
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    QQ39_16145
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    QQ39_16145
Enzymes [BR:pfq01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     QQ39_16145
Exosome [BR:pfq04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   QQ39_16145
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III DUF2802
Motif
Other DBs
NCBI-ProteinID: AKJ43400
UniProt: A0A0G3CRR6
Position
complement(3702495..3703673)
Genome map
AA seq 392 aa AA seqDB search
MSDIVIVNAARTAIGSFGGALASVSAPKLGTLVAEEVIKRAGIEPGVIDEVILGNVLQSG
LGQNPARQAALNAGIPQSVPATTINVVCGSGLKSVMMAAQMIAAGDAQTVLAGGMENMSA
APYLLDKARWGYRMGNGTLVDSVVHDGLSCAFNQYHMGMTAENVAERYGITRAEQDEVAL
RSQQRAVAAINSGAFSQEITPVTIRQKKGDIVFNQDEYPRAEASAEALAKLRPAFKADGS
VTAGNASGINDGAAALIVMSAERAKALGLKPMARIRGYGTGGVDPAFMGMGPIPATRKAL
EKARLSMADIDLIEANEAFAAQFIAVGRELCFDVEKTNVNGGAIALGHPIGASGARILVT
LLHVLQARDKTFGLATLCVGGGQGVSVIVERI
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgagtgatattgttattgttaatgccgcaagaacggcgattggtagctttggcggggcg
ttagcatcggtttctgcccctaaattaggcacgttggttgcggaagaggtgataaagcgc
gctggtattgagcccggcgtgatcgatgaagttattttgggcaatgtgctgcaatccggg
ctggggcaaaaccctgcgcgtcaggctgcgctgaacgccggtataccgcagagcgtaccg
gcaaccaccattaatgtggtatgcggttcgggtttaaaaagcgtgatgatggcggcgcaa
atgatcgccgctggcgatgcgcaaacggtactggctggtggcatggagaatatgtccgcc
gccccttacttgctggataaagcgcgttggggataccggatgggcaatggcactttagtg
gatagcgtggttcacgatgggttgagctgcgcatttaatcaatatcatatgggcatgacc
gccgagaatgttgctgagcgctacgggattactcgagcagaacaggatgaagtggctttg
cgttcacagcagcgcgcggtggcagcgataaatagcggtgcttttagccaagagataacg
ccggtcactattcgtcagaaaaagggggatattgtctttaatcaggatgaatatccgaga
gcagaagcctctgctgaggcattagccaagctgcgtcccgcgtttaaagcggacggaagc
gtcacggcaggtaatgcatccggcatcaacgatggcgctgcggcattgattgtcatgagt
gccgaaagagcgaaagcccttggcttgaaaccgatggcgcgcattcgcggctacggcacg
ggcggtgtcgatccggcctttatgggcatgggaccgattcctgccacccgcaaagcgctg
gaaaaagcccgcttaagtatggccgatatcgatctgattgaagctaacgaagcgtttgct
gcccaatttatcgccgttggccgggagctgtgcttcgatgtggaaaaaactaacgttaac
ggtggtgctattgcgctggggcatcctatcggtgcatccggtgcacgtattctggtgacc
ttactgcatgtgctacaagctcgggataaaacctttggactggccacgctatgcgtgggt
ggtggacagggtgtgtcagtgattgttgaacggatctaa

DBGET integrated database retrieval system