KEGG   Propionibacterium freudenreichii: PFREUD_00540Help
Entry
PFREUD_00540      CDS       T01252                                 

Gene name
rmlC
Definition
dTDP-4-dehydrorhamnose reductase / dTDP-4-dehydrorhamnose 3,5-epimerase (EC:1.1.1.133 5.1.3.13)
Orthology
K00067  
dTDP-4-dehydrorhamnose reductase [EC:1.1.1.133]
K01790  
dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
pfr  Propionibacterium freudenreichii
Pathway
Streptomycin biosynthesis
Polyketide sugar unit biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Polyketide sugar unit biosynthesis [PATH:pfr00523]
Metabolism; Biosynthesis of other secondary metabolites; Streptomycin biosynthesis [PATH:pfr00521]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(66685..68169)
Genome map
AA seq 494 aa AA seqDB search
MRRRGTDTMALDHEKQLAATTTPIPGFLVFDLTVHGDNRGWFKENWQRAKMTALGLPDFG
PVQNNISFNDEVGVTRGIHAEPWDKFISVATGRVFGAWVDLREGPSFGTVFTCEIDPGVA
VYVPWGVGNAYQTLEPNTAYTYLVNAHWSPEAKYTFLNLADETVAIDWPIALDDAILSDK
DRAHPRLDAVTPFPPAMPRVLVTGAHGQLGRALMAQLPDAGFLPVGVDLDKLNIADRASV
DAYDWSTVDVIVNAAAWTDVDGAETAQGRPRAWAANATGPANLARVATEHGLTLVHISSE
YTFDGTRAPHREDEMPSPLGVYGQSKAGGDAAVAATPRHYLVRTSWVVGEGKNFVRTMVD
LAGRGIAPKVVDDQVGRLTFTTDLAAGIIHLLRHGAAWGTYNLSNEGTPLSWAAVAKRVF
ALSGHDPQDVSPISTAEYFAGKDAAPRPADSTLDLTRIEATGFRPPSMEERLDAYVAQLR
RDGSGQQPTVNRPD
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atgcggcgcaggggcactgacaccatggcgcttgaccacgagaagcagctggccgccacc
accaccccgattccgggcttcctggtgttcgacctcaccgtgcacggcgacaaccggggc
tggttcaaggagaactggcagcgcgccaagatgaccgcgcttggtctgcccgacttcggc
ccggtgcagaacaacatctcgttcaacgatgaggtgggcgtcacccgcggcatccatgcc
gagccctgggacaagttcatctcggtggccaccggccgcgtcttcggcgcctgggtggac
ctgcgcgagggtcccagcttcggcaccgtgttcacctgcgagatcgatcccggcgtggcc
gtctacgtgccgtggggcgtgggcaacgcctaccagacgctggagccgaacaccgcctac
acctacctggtgaatgcgcactggtcgcccgaggcgaagtacaccttcctcaacctggcc
gatgagaccgtggccatcgactggcccattgcgctggacgacgcgatcctgtcggacaag
gaccgcgcccatccgcgcctcgacgcggtgacgcccttccccccggcgatgccgagggtg
ctggtgaccggtgcccacggccagctgggacgcgcgctcatggcgcagctgcccgatgcc
ggcttcctcccggtgggcgtcgacctcgacaagctcaacatcgccgaccgggccagtgtg
gacgcctacgactggagcaccgtcgacgtcatcgtgaatgcggcggcctggaccgacgtc
gatggtgccgagaccgcccagggcaggccgcgggcatgggccgcgaacgccaccgggccg
gcaaacctcgcccgggttgccaccgagcacgggctcacgctggtgcacatctcgtcggaa
tacacctttgacggcacccgggcaccgcatcgcgaggacgagatgccgagccccctgggc
gtctacgggcagtcgaaggccggcggcgacgccgccgtggccgccacgcccaggcattac
ctggtgcgcaccagctgggtggtgggcgagggcaagaacttcgtgcgcaccatggttgac
ctggccgggcgcggcatcgcccccaaggtggtggacgaccaggtgggacgcctcaccttc
accaccgacctggccgccggcatcatccacctgctgcgccacggcgccgcctggggcacc
tacaacctgtccaacgagggcaccccgctgagctgggccgcggtggccaagcgcgtcttc
gccctgagcggccacgacccgcaggatgtgtcaccgatcagcacggcggagtacttcgcc
ggcaaggacgccgcaccgcgccccgccgacagcacgctggacctcacccgcatcgaggcc
accggcttccgtccgccctccatggaggagcgcctggacgcctatgtggcgcagttgcgc
cgggacgggtccggacaacagccgacagtgaaccgccctgattga

DBGET integrated database retrieval system