KEGG   Propionibacterium freudenreichii: PFREUD_00540Help
Entry
PFREUD_00540      CDS       T01252                                 

Gene name
rmlC
Definition
dTDP-4-dehydrorhamnose reductase / dTDP-4-dehydrorhamnose 3,5-epimerase (EC:1.1.1.133 5.1.3.13)
Orthology
K00067  
dTDP-4-dehydrorhamnose reductase [EC:1.1.1.133]
K01790  
dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
pfr  Propionibacterium freudenreichii
Pathway
Streptomycin biosynthesis
Polyketide sugar unit biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pfr00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    PFREUD_00540 (rmlC)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    PFREUD_00540 (rmlC)
Enzymes [BR:pfr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.133  dTDP-4-dehydrorhamnose reductase
     PFREUD_00540 (rmlC)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     PFREUD_00540 (rmlC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(66685..68169)
Genome map
AA seq 494 aa AA seqDB search
MRRRGTDTMALDHEKQLAATTTPIPGFLVFDLTVHGDNRGWFKENWQRAKMTALGLPDFG
PVQNNISFNDEVGVTRGIHAEPWDKFISVATGRVFGAWVDLREGPSFGTVFTCEIDPGVA
VYVPWGVGNAYQTLEPNTAYTYLVNAHWSPEAKYTFLNLADETVAIDWPIALDDAILSDK
DRAHPRLDAVTPFPPAMPRVLVTGAHGQLGRALMAQLPDAGFLPVGVDLDKLNIADRASV
DAYDWSTVDVIVNAAAWTDVDGAETAQGRPRAWAANATGPANLARVATEHGLTLVHISSE
YTFDGTRAPHREDEMPSPLGVYGQSKAGGDAAVAATPRHYLVRTSWVVGEGKNFVRTMVD
LAGRGIAPKVVDDQVGRLTFTTDLAAGIIHLLRHGAAWGTYNLSNEGTPLSWAAVAKRVF
ALSGHDPQDVSPISTAEYFAGKDAAPRPADSTLDLTRIEATGFRPPSMEERLDAYVAQLR
RDGSGQQPTVNRPD
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atgcggcgcaggggcactgacaccatggcgcttgaccacgagaagcagctggccgccacc
accaccccgattccgggcttcctggtgttcgacctcaccgtgcacggcgacaaccggggc
tggttcaaggagaactggcagcgcgccaagatgaccgcgcttggtctgcccgacttcggc
ccggtgcagaacaacatctcgttcaacgatgaggtgggcgtcacccgcggcatccatgcc
gagccctgggacaagttcatctcggtggccaccggccgcgtcttcggcgcctgggtggac
ctgcgcgagggtcccagcttcggcaccgtgttcacctgcgagatcgatcccggcgtggcc
gtctacgtgccgtggggcgtgggcaacgcctaccagacgctggagccgaacaccgcctac
acctacctggtgaatgcgcactggtcgcccgaggcgaagtacaccttcctcaacctggcc
gatgagaccgtggccatcgactggcccattgcgctggacgacgcgatcctgtcggacaag
gaccgcgcccatccgcgcctcgacgcggtgacgcccttccccccggcgatgccgagggtg
ctggtgaccggtgcccacggccagctgggacgcgcgctcatggcgcagctgcccgatgcc
ggcttcctcccggtgggcgtcgacctcgacaagctcaacatcgccgaccgggccagtgtg
gacgcctacgactggagcaccgtcgacgtcatcgtgaatgcggcggcctggaccgacgtc
gatggtgccgagaccgcccagggcaggccgcgggcatgggccgcgaacgccaccgggccg
gcaaacctcgcccgggttgccaccgagcacgggctcacgctggtgcacatctcgtcggaa
tacacctttgacggcacccgggcaccgcatcgcgaggacgagatgccgagccccctgggc
gtctacgggcagtcgaaggccggcggcgacgccgccgtggccgccacgcccaggcattac
ctggtgcgcaccagctgggtggtgggcgagggcaagaacttcgtgcgcaccatggttgac
ctggccgggcgcggcatcgcccccaaggtggtggacgaccaggtgggacgcctcaccttc
accaccgacctggccgccggcatcatccacctgctgcgccacggcgccgcctggggcacc
tacaacctgtccaacgagggcaccccgctgagctgggccgcggtggccaagcgcgtcttc
gccctgagcggccacgacccgcaggatgtgtcaccgatcagcacggcggagtacttcgcc
ggcaaggacgccgcaccgcgccccgccgacagcacgctggacctcacccgcatcgaggcc
accggcttccgtccgccctccatggaggagcgcctggacgcctatgtggcgcagttgcgc
cgggacgggtccggacaacagccgacagtgaaccgccctgattga

DBGET integrated database retrieval system