KEGG   Propionibacterium freudenreichii subsp. shermanii CIRM-BIA1: PFREUD_01050Help
Entry
PFREUD_01050      CDS       T01252                                 

Gene name
mutM1
Definition
(GenBank) Formamidopyrimidine-DNA glycosylase (Fapy-DNA glycosylase) (DNA-(apurinic or apyrimidinic site) lyase mutM) (AP lyase mutM) (EC:3.2.2.23 4.2.99.18)
  KO
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
pfr  Propionibacterium freudenreichii subsp. shermanii CIRM-BIA1
Pathway
Base excision repair
Brite
KEGG Orthology (KO) [BR:pfr00001]
 Genetic Information Processing
  Replication and repair
   03410 Base excision repair
    PFREUD_01050 (mutM1)
Enzymes [BR:pfr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.23  DNA-formamidopyrimidine glycosylase
     PFREUD_01050 (mutM1)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.99  Other carbon-oxygen lyases
    4.2.99.18  DNA-(apurinic or apyrimidinic site) lyase
     PFREUD_01050 (mutM1)
DNA repair and recombination proteins [BR:pfr03400]
 Prokaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     PFREUD_01050 (mutM1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(131814..132677)
Genome map
AA seq 287 aa AA seqDB search
MPELPQVEALADFLRTDLVGSVIERLEVGAISALKTFDPPPDALVGRTVTAINRFGKHLD
VDAGGLHLVFHLARAGWLVWREKVPSTVIKPGKSRIALRVRLQGGAGFDLTEAGTQRKLA
VWIVRDPQQVPSIASLGPDPMAPGFTPAVFRQILAGAGRAQLKGILRDQHVIAGIGNAYS
DEILHDAKLSPFKPAANLTDDEVERLYAAIRDGLAAATERARGLAARDIKADKRAQLRIH
GHAGDPCPVCGTPIASVNFADSSLQYCPVCQTGGKKLADRRMSKLLK
NT seq 864 nt NT seq  +upstreamnt  +downstreamnt
atgcctgagctgccccaggtggaggccctggccgatttcctgcgcaccgatctggtgggt
tcggtgatcgaacgcctcgaggtgggcgcgatcagcgcgctgaagacctttgacccgccg
cccgatgcgctggtgggccgcaccgtcaccgccatcaaccgcttcggcaagcacctcgac
gtggatgccgggggcctgcacctggtgttccacctggcgcgggccggctggctggtgtgg
cgcgagaaggtgccgtccaccgtgatcaagccgggcaagagccgcatcgcgctgcgggtg
cggctgcagggtggcgccggcttcgacctcaccgaggccggcacgcaacgcaagctggcc
gtgtggatcgtgcgcgacccccagcaggtgccgtcgatcgccagcctggggcccgatccg
atggcgcccgggttcacgccggcggtgttccggcagatcctggcaggggccgggcgcgcc
cagttgaagggcatcctgcgtgaccagcacgtgattgccggcatcggcaacgcctacagc
gacgagatcctgcacgacgcaaagctgagccccttcaagccggccgccaacctgaccgat
gacgaggtcgagcggctgtatgctgccatccgcgacggcctggccgccgctaccgagcgg
gcgcgcgggctggccgccagggacatcaaggccgacaagcgcgcccagctgcgcatccat
ggccacgccggcgatccctgccccgtgtgcggcacgccgatcgcgtcggtgaacttcgcc
gactcgtcgctgcagtattgcccggtgtgccagaccggcggcaagaagctggccgatcgt
cgcatgagcaagctgctcaaatag

DBGET integrated database retrieval system