KEGG   Propionibacterium freudenreichii subsp. shermanii CIRM-BIA1: PFREUD_02210Help
Entry
PFREUD_02210      CDS       T01252                                 

Gene name
bkdB
Definition
(GenBank) dihydrolipoyllysine-residue (2-methylpropanoyl)transferase. Lipoamide acyltransferase component of branched-chain alpha-keto acid dehydrogenase complex (E2) (Dihydrolipoamide branched chain transacylase)
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
pfr  Propionibacterium freudenreichii subsp. shermanii CIRM-BIA1
Pathway
pfr00010  Glycolysis / Gluconeogenesis
pfr00020  Citrate cycle (TCA cycle)
pfr00620  Pyruvate metabolism
pfr01100  Metabolic pathways
pfr01110  Biosynthesis of secondary metabolites
pfr01120  Microbial metabolism in diverse environments
pfr01130  Biosynthesis of antibiotics
pfr01200  Carbon metabolism
Module
pfr_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:pfr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PFREUD_02210 (bkdB)
   00020 Citrate cycle (TCA cycle)
    PFREUD_02210 (bkdB)
   00620 Pyruvate metabolism
    PFREUD_02210 (bkdB)
Enzymes [BR:pfr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     PFREUD_02210 (bkdB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl Biotin_lipoyl_2 GCV_H Transferase MSA-2c DUF1631
Motif
Other DBs
NCBI-ProteinID: CBL55736
UniProt: D7GI14
Position
261901..263247
Genome map
AA seq 448 aa AA seqDB search
MPEYNMPDPGEGLTEADIVEWHVKVGDQVKVNDNLLDIETAKSLVELPSPFAGKVTKIYA
EAGATVAVGAPIVFIDDGTGPAPEHDGGAPAQGAEPGAQSSPAQASSAQSSSNQSGPAQS
SAPAPAAQGPAKAAPAAARPDADEASAQRDLDGGMTGERLLSLDELPASKPTQQTVRQML
VGYGPADESTPSSTERRRRAHQVSRRGANERALRDEEIPVDTVRRLTARNVVHSRTSKVH
TTAWVSTDVSGTMELVANLRKRREFKDLHVTALLVWCKAVCLAMRNNPMLNASWEDGSER
IILHHDVNIGIAADTPRGLMVPVIKQAQNRDLLSMADELTRLVNLAKAGTLQPSDYRDGT
FTITNVGGLGLDAGTPIINGSESAILAMGAITRQPWVVGQGDDEKIVPRWVTTLSISFDH
RLIDGAIASRFLRDLAALVRDPAMAMAY
NT seq 1347 nt NT seq  +upstreamnt  +downstreamnt
atgcccgaatacaacatgcccgacccgggcgagggcctcaccgaggccgacatcgtcgaa
tggcacgtgaaggtcggcgaccaggtgaaggtcaacgacaacctgctcgacatcgagacc
gccaagtcgctggtcgagctgccgtcgccgttcgccggcaaggtgaccaagatctatgcc
gaggcgggcgccaccgtggccgtgggtgcgccgatcgtcttcatcgacgacggcaccggc
cccgcccccgagcatgacggcggtgcgcctgcgcagggtgccgagccgggcgcccagtcc
agtccagcccaggccagttcagcccagtccagctcgaaccagtccggcccggcccagtcc
agcgcccctgcgccggccgcccagggtccggccaaggcggcacctgccgcggcgcgtccc
gatgccgacgaggcgtcggcccagcgcgacttggacggcggcatgaccggtgagcggctg
ttgtcgctcgatgagcttccggcgtcgaagccgacccagcagaccgtgcgccagatgttg
gtcggctacggtcccgccgacgagtccacgcccagctccaccgagcgtcgtcggcgtgcc
caccaggtgagccgccgtggtgccaacgagcgtgccctgcgcgacgaggagatccccgtc
gacacggtgcgacgcctcaccgcgcgcaatgtggtgcattcgcgcacgtccaaggtgcac
accaccgcatgggtgagcacggatgtgagcggcacgatggagctggtggccaacctgcgc
aagcgccgcgagttcaaggacctgcatgtcaccgccctgctggtgtggtgcaaggcggtc
tgcctggccatgcgcaacaatcccatgctcaatgccagctgggaggacggctcggagcgc
atcatcctgcaccacgacgtgaacatcggcatcgccgctgacacgccgcgtggcctcatg
gtgccggtgatcaagcaggcgcagaaccgcgacctgctgtcgatggccgacgagctgacc
cgcctggtcaacctggccaaggccggcacgctgcaacccagcgactaccgcgacggcacc
ttcaccatcaccaacgtgggaggccttgggctggacgcgggcaccccgatcatcaatggc
tccgagagcgcgatcctggcgatgggtgcgatcacccggcagccctgggtcgtgggtcag
ggcgacgacgagaagatcgtgccgcgctgggtcaccacattgtcgatctcgttcgaccat
cgcctgatcgacggggcgatcgcctcgcggttcctgcgcgaccttgccgcgctggtgcgc
gaccccgcgatggccatggcgtattag

DBGET integrated database retrieval system