KEGG   Propionibacterium freudenreichii subsp. shermanii CIRM-BIA1: PFREUD_02600Help
Entry
PFREUD_02600      CDS       T01252                                 

Gene name
ppgK
Definition
(GenBank) Polyphosphate glucokinase
  KO
K00886  polyphosphate glucokinase [EC:2.7.1.63]
Organism
pfr  Propionibacterium freudenreichii subsp. shermanii CIRM-BIA1
Pathway
pfr00010  Glycolysis / Gluconeogenesis
pfr00520  Amino sugar and nucleotide sugar metabolism
pfr01100  Metabolic pathways
pfr01110  Biosynthesis of secondary metabolites
pfr01120  Microbial metabolism in diverse environments
pfr01130  Biosynthesis of antibiotics
pfr01200  Carbon metabolism
Module
pfr_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:pfr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PFREUD_02600 (ppgK)
   00520 Amino sugar and nucleotide sugar metabolism
    PFREUD_02600 (ppgK)
Enzymes [BR:pfr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.63  polyphosphate---glucose phosphotransferase
     PFREUD_02600 (ppgK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK DUF4798 Toprim_4
Motif
Other DBs
NCBI-ProteinID: CBL55781
UniProt: D7GI59
Position
complement(314916..315701)
Genome map
AA seq 261 aa AA seqDB search
MLGIDVGGSGIKGAPVDLEAGEMAVPRRKVLTPQPSTPEACAGAMATIIEQFADQIDGPI
GVAVPAPVLHGVTPFMANLDQSWVGLDAAAYLSEKLGREVVLVNDADAAGVAEMQYGAGR
GKQGTVVLTTLGTGVGTALFHDGRLVPNTEFGHIEINGRDAESRAASSYMEREHISYKKW
AKHLQRYYSTLEKLLWPDLFIVGGGVSREYKRFLPLLNLQTPIVPASLRNGAGTIGAALA
ASLRVGANVPPGAQRIASVPD
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
gtgttgggaatcgatgtcggcggctcgggcatcaagggtgccccggtggacctcgaggcc
ggggaaatggccgtgccgcgacgcaaggtattgacgccccagccctccactccggaggct
tgtgccggggccatggccacgatcatcgagcagttcgccgatcagatcgacggtcccatc
ggcgtcgccgtgccggcgccggtgctccacggcgtgacgcccttcatggccaacctcgac
cagtcgtgggtcggcctcgatgcggccgcctatctctccgagaagctcggccgtgaggtg
gtgctggtcaacgacgctgacgccgccggggtggccgagatgcaatacggcgcgggtcgt
ggcaagcagggcaccgtggtgctgaccacgctgggtaccggcgtgggtaccgccctgttc
catgacggacgcctggtgcccaacaccgagttcgggcacatcgagatcaacggtcgcgat
gccgagagccgcgcggcgtcgtcgtacatggaacgcgagcacatcagctacaagaaatgg
gccaagcacctgcagcgctattactccaccctggagaagttgctgtggcccgacctgttc
atcgtgggcggcggggtgagtcgtgagtacaagcggttcctgccgctgctcaacctgcag
acgccgatcgttccggccagcctgcgcaatggcgccggcacgatcggggcggcactggcc
gcatcattgcgcgtcggggcgaacgtgccgccgggggcgcaacgcattgcgtcggtgccc
gactag

DBGET integrated database retrieval system